Labshake search
Citations for Thermo Fisher :
901 - 950 of 10000+ citations for Zika Virus NS1 Proteins Uganda Suriname Strains Duo Pack since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Evolutionary Biology 2020Quote: Concentrated virus particles were treated with RNase A before extraction of RNA using Trizol LS (Ambion, Life Technologies). The aqueous fraction of the Trizol lysate was precipitated with ethanol and was resuspended in 10 mM Tris pH 8.0 before purification using the QIAamp viral RNA mini kit (QIAGEN ...
-
bioRxiv - Evolutionary Biology 2020Quote: Concentrated virus particles were treated with RNase A before extraction of RNA using Trizol LS (Ambion, Life Technologies). The aqueous fraction of the Trizol lysate was precipitated with ethanol and was resuspended in 10 mM Tris pH 8.0 before purification using the QIAamp viral RNA mini kit (QIAGEN ...
-
bioRxiv - Microbiology 2021Quote: ... 12 µL of SARS-CoV-2 stock virus (USA_WA1/2020; 8.3×104 pfu) in OptiMEM supplemented with 1x antibiotic/antimycotic (Gibco) was pipetted directly onto each surface being tested and spread with a pipette tip to facilitate efficient drying ...
-
bioRxiv - Microbiology 2021Quote: ... Transmissible gastroenteritis virus [TGEV] and Swine deltacoronavirus [SDCoV] (VetMAX™ PEDV/TGEV/SDCoV, Thermo Fisher Scientific, MA, USA) and Senecavirus A [SVA] (EXOone Seneca Virus Valley ...
-
bioRxiv - Microbiology 2021Quote: ... The spike of the SARS-CoV-2.SctΔ19 B.1.617.2 (delta) virus was generated (GeneArt Gene Synthesis, ThermoFisher Scientific) from the full protein sequence of the original SARS-CoV-2 isolate Wuhan-Hu-1 (WH1 ...
-
bioRxiv - Immunology 2020Quote: ... Reverse transcription of isolated RNA was performed using a Moloney murine leukemia virus-reverse transcriptase kit (Life Technologies) and oligo(dT ...
-
bioRxiv - Synthetic Biology 2022Quote: ... undiluted SINV-containing supernatants were combined with the TaqMan™ Fast Virus 1-Step Master Mix (ThermoFisher, #4444434) and the appropriate primer-probe sets in technical triplicates ...
-
bioRxiv - Microbiology 2022Quote: ... Premixes were prepared for each amplification reaction using TaqMan Fast Virus 1-Step Master Mix (Thermo Fisher Scientific), according to the manufacturer’s protocol ...
-
bioRxiv - Synthetic Biology 2022Quote: ... C and S genes of the Hepatitis B virus (accession number: KY00323035) was ordered from GeneArt (ThermoFisher Scientific) and is available from Addgene (Addgene # 179155).
-
bioRxiv - Neuroscience 2023Quote: ... C-Myc) introduced by Sendai virus according to the manufacturer’s instructions (Cytotune iPS 2.0 Sendai reprogramming kit, ThermoFisher) or by using an episomal method ...
-
bioRxiv - Neuroscience 2024Quote: Human fibroblast cells were reprogrammed using the Sendai virus-based CytoTune iPS 2.0 kit (CytoTune 2.0, Invitrogen, A16517). Fibroblasts were plated in six-well plates two days before transduction to achieve a density of 2 × 105 to 3 × 105 cells per well ...
-
bioRxiv - Microbiology 2024Quote: ... the cells were incubated with 10-fold serial dilutions of the virus for 1 h and overlaid with 0.55% methylcellulose or 1.0% cellulose in minimal essential medium (MEM) (Gibco) supplemented with 2% FBS (Corning ...
-
bioRxiv - Microbiology 2024Quote: ... and 2 U/µl of M-MulV-RT (Reverse transcriptase of Moloney Murine Leukemia Virus; Thermo Scientific, USA).
-
bioRxiv - Genomics 2024Quote: ... Virus was produced by transfecting HEK293T cells with the plasmid and the Lipofectamine 3000 kit (Thermo Fisher Scientific). U87MG were transduced with the supernatant containing the NY-ESO-1 virus ...
-
bioRxiv - Microbiology 2024Quote: ... and CC81 (feline cell line transformed by mouse sarcoma virus ECACC 90031403) cells were grown in Dulbecco’s modified Eagle’s medium (DMEM)-high glucose (GlutaMAX, Gibco) supplemented with 1% penicillin/streptomycin and 10% fetal bovine serum (Gibco ...
-
bioRxiv - Immunology 2024Quote: ... in virus growth medium (1X MEM [Gibco 11095080], 5% FBS [Hyclone SH30070.03HI] and 1% Penn-Strep [Gibco 10378016]). Monoclonal antibody dilution plates were prepared similarly to serum dilution plates ...
-
bioRxiv - Bioengineering 2024Quote: ... Virus production medium contained DMEM supplemented with L-glutamine and sodium pyruvate and 10% heat-inactivated FBS (Gibco). Viral supernatants collected roughly 48- and 72-hours post-transfection were sterile-filtered through a 0.45-micron filter and concentrated in 100kDa molecular weight cutoff filters.
-
bioRxiv - Cell Biology 2023Quote: ... After a brief culture to expand the erythroblast population a Sendai virus based approach (CytoTune 2.0 Kit, Invitrogen) was used to express the Yamanaka factors without any genomic integration (27) ...
-
bioRxiv - Microbiology 2023Quote: ... The cell and virus lysates were Western blotted and probed with a goat polyclonal anti-gp120 antibody (Invitrogen), the 4E10 anti-gp41 antibody (NIH HIV Reagent Program ...
-
bioRxiv - Biochemistry 2023Quote: Bacmid preparation and virus production were performed according to the Bac-to-Bac baculovirus system manual (Gibco, Invitrogen). Spodoptera frugiperda Sf9 cells at a density of 3 × 106 cells/ml were co-infected with baculoviruses encoding receptor and Gi trimer at the ratio of 1:1 ...
-
bioRxiv - Biochemistry 2023Quote: Bacmid preparation and virus production were performed according to the Bac-to-Bac baculovirus system manual (Gibco, Invitrogen). Spodoptera frugiperda Sf9 cells at a density of 3 × 106 cells/ml were co-infected with baculoviruses encoding receptor and Gi trimer at the ratio of 1:1 ...
-
bioRxiv - Cancer Biology 2023Quote: ... Epstein–Barr virus-transformed lymphoblasts were obtained from Coriell Cell Repositories and were grown in RPMI 1640 (Gibco) supplemented with 10% FBS and penicillin/streptomycin (Gibco) ...
-
bioRxiv - Microbiology 2023Quote: ... l ml of the seed virus was treated with 2 μl TURBO DNase (Thermo Fisher Scientific, Cat# AM2238) and incubated at 37°C for l h ...
-
bioRxiv - Immunology 2023Quote: ... Stock virus was sub-passaged through Madin-Darby canine kidney (MDCK) cells in Dulbecco’s modified Eagle’s medium (DMEM; Gibco), harvested as tissue culture supernatant and viral titres determined by cytopathic effects on MDCK cells and expressed as the mean log10 tissue culture infective dose required to kill 50% of the cells (TCID50 ...
-
bioRxiv - Neuroscience 2023Quote: ... cDNA synthesis and PCR were performed using TaqMan™ Fast Virus 1-Step Multiplex Master Mix (#4331182; ThermoFisher). Probes were used to detect the mouse transcripts of Htr2a and Gapdh (Mm00555764_m1 and Mm99999915_g1 4448892 ...
-
bioRxiv - Cell Biology 2023Quote: ... infected with Sendai virus containing Yamanaka factors from the CytoTune™-iPS 2.0 Sendai Reprogramming Kit (ThermoFisher, A165167) according to manufacturer recommendations ...
-
bioRxiv - Biochemistry 2023Quote: ... 8 ml P4 virus was used to infect 800 ml cultures of Expi293F GnTI-Cells (Thermo Fisher Scientific) cells at 2-3 × 106 cells supplemented with 1% Fetal Bovine Serum (FBS) ...
-
bioRxiv - Immunology 2022Quote: Protein-protein crosslinking using BMOE (Thermo Scientific) was carried out according to the product manual ...
-
bioRxiv - Developmental Biology 2021Quote: ... Protein A and Protein G Dynabeads (Invitrogen) were incubated for 6 hours at 4°C with 5 μg H3K27me3 (07-449 ...
-
bioRxiv - Plant Biology 2023Quote: ... Protein A and Protein G Dynabeads (Invitrogen) were added and incubated at 4 °C for 2 hours with rotation ...
-
bioRxiv - Immunology 2022Quote: ... Protein A or protein G Dynabeads (Invitrogen) were prepared according to manufacturer’s protocol ...
-
bioRxiv - Genomics 2022Quote: ... Protein A and Protein G Dynabeads (Invitrogen) premixed at 1:1 ratio were used for pre-clearing for 1 hour at 4°C ...
-
bioRxiv - Biochemistry 2023Quote: Protein-protein crosslinking using BMOE (Thermo Scientific) was carried out according to the product manual ...
-
bioRxiv - Immunology 2020Quote: ... Precipitated proteins were bound to 50:50 Protein A: Protein G Dynabeads (Invitrogen) for one to two hours and washed extensively with IP wash buffer (50 mM Tris pH 8 ...
-
bioRxiv - Cell Biology 2023Quote: ... Proteins were incubated with fast-flow protein G- or protein A-Dynabeads (Invitrogen) for 2 hours and centrifuged to eliminate nonspecifically bound proteins ...
-
bioRxiv - Developmental Biology 2021Quote: Escherichia coli (E. coli) strain DH5α (Toyobo, Osaka, Japan) and BL21(de3) pLysS (C606003, ThermoFisher Scientific) were used for DNA cloning and protein expression ...
-
bioRxiv - Molecular Biology 2021Quote: ... Genomic DNA of the test strains was digested by NotI restriction enzyme (Gibco-BRL, Gaithersburg, MD) and Salmonella enterica serovar Braenderup was digested using XbaI ...
-
bioRxiv - Developmental Biology 2020Quote: RNA was collected from indicated strains as well as from RNAi treatments using TRIZOL Reagent (Invitrogen). Three biological replicates ...
-
bioRxiv - Molecular Biology 2021Quote: RNA from indicated strains was extracted from mixed stage populations of animals using TRIzol reagent (Invitrogen), then alcohol precipitated ...
-
bioRxiv - Biochemistry 2020Quote: ... Saccharomyces cerevisiae strain InvSc1 (MATa adc2-1 his3-11,15 leu2-3,112 trp1-1 ura3-52; Invitrogen) was grown in synthetic dextrose medium (5 mL ...
-
bioRxiv - Cancer Biology 2020Quote: ... The ligated vectors were transformed into Stbl3 strain of Escherichia coli (Thermo Fisher Scientific, Waltham, MA) and selected with 100 µg/mL ampicillin on LB/agar plates ...
-
bioRxiv - Biophysics 2021Quote: ... ZIKV strain UniProt ID: A0A024B7W1) (NH2-AARAAQKRTAAGIMKNPVVDGIVVTDIDMTIDPQVEKK-COOH) with 96% purity was purchased from Thermo scientific USA and dissolved in buffer consisting of 20 mM sodium phosphate buffer (pH 7.4) ...
-
bioRxiv - Microbiology 2020Quote: ... The purified plasmids harboring the genes of interest were transformed into yeast strain INVSc1 (ThermoFisher Scientific) for protein expression and purification ...
-
bioRxiv - Cell Biology 2021Quote: Leishmania mexicana (MNYC/BZ/62/M379) derived strains were grown at 25°C in HOMEM (Gibco) supplemented with 10% (v/v ...
-
bioRxiv - Biophysics 2020Quote: ... Freshly prepared competent cells of a strain of Pichia pastoris SMD 1163 (Δhis4 Δpep4 Δprb1, Invitrogen) were electro-transformed with individually PmeI-HF (New England Biolabs ...
-
bioRxiv - Genomics 2022Quote: ... vector and amplified in DH5α strain of Escherichia coli (E coli) (Life Technologies, Grand Island NY). After amplification ...
-
bioRxiv - Microbiology 2021Quote: ... coli strains were grown for 24 h at 37°C in 10 mL DMEM-HEPES (Gibco), resuspended in 500µL HBSS (Invitrogen ...
-
bioRxiv - Biophysics 2020Quote: Plasmodium falciparum strains W2 and 3D7 were cultured in 50 mL flasks containing RPMI (Thermo Fisher #31800089 ...
-
bioRxiv - Plant Biology 2019Quote: ... coli strain K12 with JCAT (Grote et al., 2005) (http://www.jcat.de/) and synthesized by Thermo Fisher Scientific (Table S3) ...
-
bioRxiv - Biochemistry 2021Quote: ... pastoris strain GS115 and the Pichia expression vector (pPIC9K) were obtained from Invitrogen (Carlsbad, CA, USA). Bovine trypsin ...