Labshake search
Citations for Peprotech :
151 - 185 of 185 citations for L Aspartic Acid N T Boc B Bz Ester 13C4 97 99%; 15N 97 99% since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2020Quote: ... H1975 cells were cultured in stem cell culture media (Advanced DMEM/F12 [Thermo Fisher Scientific], 1% Glutamax, B-27 supplement [Thermo Fisher Scientific], 10 ng/mL recombinant human HB-EGF [PeproTech, Cranbury ...
-
bioRxiv - Neuroscience 2022Quote: ... hNPCs were plated on poly-L-ornithine- and laminin-coated plates and were differentiated with growth media (without FGF-b) supplemented with 25ng/mL recombinant human glial-derived neurotrophic factor (GDNF; PeproTech US, NJ). Fifty percent of cell media were removed every three to four days and replaced with fresh GDNF supplemented media ...
-
bioRxiv - Bioengineering 2022Quote: ... macrophage colony stimulating factor (M-CSF) and receptor activator of nuclear factor kappa-B ligand (RANKL) were from PeproTech (London, United Kingdom). Bombyx mori L ...
-
bioRxiv - Neuroscience 2024Quote: ... B27 Supplement and Trace Element B) supplemented with Platelet-Derived Growth Factor-AA (PDGFA) (30 ng/ml) and basic Fibroblast Growth Factor (bFGF, Peprotech, 100-18B) (30 ng/ml ...
-
bioRxiv - Bioengineering 2020Quote: ... Primary human T cells were cultured in complete RPMI 1640 supplemented with 100 U/mL recombinant human IL-2 (PeproTech, 200-02). Cells were cultured at 37°C in a humidified 5% CO2 incubator.
-
bioRxiv - Bioengineering 2023Quote: ... Primary human T cells were cultured in complete RPMI 1640 supplemented with 100□U/ml recombinant human IL-2 (PeproTech, 200-02). All mammalian cells were cultured at 37□°C in a humidified 5% CO2 incubator.
-
bioRxiv - Cancer Biology 2024Quote: ... according to the manufacturer’s instructions (20 μL of beads per 1 million T-cells) for 5 days and grown in the presence of recombinant interleukin-7 (PeproTech, 200-07) and interleukin-15 (PeproTech ...
-
bioRxiv - Cancer Biology 2024Quote: ... according to the manufacturer’s instructions (20 μL of beads per 1 million T-cells) for 5 days and grown in the presence of recombinant interleukin-7 (PeproTech, 200-07) and interleukin-15 (PeproTech ...
-
bioRxiv - Cell Biology 2021Quote: ... composed of complete A-RPMI supplemented with 2 μM Retinoic acid (Stemgent) and Fibroblast growth factor 2 (Peprotech). IMCs were cultivated for 7 days in complete A-RPMI to obtain PTC ...
-
bioRxiv - Immunology 2020Quote: ... Cells were treated with Mouse active perforin (#APB317Mu01, Cloud-Clone Corp., Katy, TX) and recombinant mouse Granzyme B (#140-03, PeproTech, Rocky Hill, NJ) for 4 to 6 hours in indi cated concentrations following manufacturer’s recommendations.
-
bioRxiv - Cancer Biology 2021Quote: ... or 2) subsequently stimulated with 5 μg/kg T cell chemokine – C-X-C motif chemokine ligand 10 (CXCL10, PeproTech, Rocky Hill, USA) (23) ...
-
bioRxiv - Immunology 2020Quote: ... Mouse T cells with the addition of mercaptoethanol and patients’ T cells were incubated in the presence of 10ng/mL of hrIL2 (PeproTech, Rocky Hill, NJ). The identity of all cell lines was evaluated using short tandem repeat profiling performed in-house at the Genomic Core Facility ...
-
bioRxiv - Immunology 2022Quote: ... bone marrow was isolated from tibiae and femurs and single-cell suspensions were cultured at 10*106 cells per 100 mm bacteriological Falcon petri dish in 10 ml complete T cell medium supplemented with 20 ng/ml GM-CSF (PeproTech, Rocky Hill, NJ). At day 3 ...
-
bioRxiv - Immunology 2024Quote: ... Matrices were placed into ImmunoCult™-XF T Cell Expansion Medium (StemCell, Cat: 10981) supplemented with rhIL-2 (200IU; Peprotech, Cat: 200-02), rhIL-7 (10ng/mL ...
-
bioRxiv - Immunology 2020Quote: ... L-glutamine and antibiotics and containing 10ng/mL recombinant human IL-7 and IL-15 (Peprotech, USA).
-
bioRxiv - Bioengineering 2020Quote: ... non-essential amino acids and human FGF2 at 10 ng/mL and human BMP4 at 20 ng/mL (both Peprotech) until day 18 ...
-
bioRxiv - Bioengineering 2022Quote: ... the spheroids were then transferred to spinal cord medium II (ScM II) with 10 nM retinoic acid and 5 ng/mL recombinant human BMP4 (Peprotech) for the next 6 days ...
-
bioRxiv - Immunology 2023Quote: ... at 1×106 cells/ml in T-175 flasks with 100 ng/ml of either GM-CSF or CSF-1 (PeproTech 300-23 or 300-25). Monocytes were incubated at 37°C/5% CO2 for up to 6 days to differentiate into macrophages ...
-
bioRxiv - Developmental Biology 2023Quote: ... the media was replaced with Xen medium containing 0.1 µM retinoic acid (Thermo Fischer, #17110052) and 10 ng/mL Activin A (Peprotech, #120-14). On Day4 ...
-
bioRxiv - Cancer Biology 2023Quote: ... Activated T-cells were kept in medium supplemented with IL-7 and IL-15 (#200-07 and #200-15, PeproTech, 10 and 5 ng/mL, respectively). Gamma-retroviral transduction was facilitated by RetroNectin (#T100B ...
-
bioRxiv - Neuroscience 2022Quote: To obtain neural rosettes the EBs were seeded on poly-l-ornithine/laminin (POLAM) coated plates with PN medium supplemented with Noggin (200ng/ml; Peprotech) and SB431542 (10 μM ...
-
Combining LSD1 and JAK-STAT inhibition targets Down syndrome-associated myeloid leukemia at its corebioRxiv - Cancer Biology 2022Quote: ... and a cytokine cocktail (FLT3-L, SCF, IL-6, IL-3, TPO; all purchased from PeproTech, Rocky Hill, NJ, USA). Samples were taken from pediatric AML patients treated as part of the AML Berlin-Frankfurt-Münster study group ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2022Quote: Bone marrow cells from femurs and tibias were cultured in presence of 100 ng/ml recombinant human FLT3-L (Peprotech). After three days of differentiation ...
-
bioRxiv - Immunology 2023Quote: ... and cultured in complete RPMI 1640 media (10% fetal bovine serum, 1% penicillin-streptomycin, 1% L-glutamine) supplemented with 10 ng/mL M-CSF (PeproTech). Cells were cultured for 5 days at 37°C in a humidified 5% CO2 atmosphere under continuous high-dose 100 ng/mL lipopolysaccharide (LPS ...
-
bioRxiv - Cell Biology 2023Quote: ... glutamine and human early-acting cytokines (SCF 300 ng/ml, Flt3-L 300 ng/ml, TPO 100 ng/ml, and IL-3 60 ng/ml; all purchased from Peprotech). All cultures were kept at 37°C in a 5% CO2 water jacket incubator (Thermo Scientific ...
-
bioRxiv - Immunology 2023Quote: ... filtered and cultured for 7 days in complete RPMI medium (RPMI-1640 medium containing L-glutamine plus 10% fetal calf serum) containing 20ng/mL recombinant GM-CSF (Peprotech).
-
bioRxiv - Neuroscience 2024Quote: ... NPC were plated on poly- L-ornithine/laminin-coated flasks at 50’000 cells/cm2 in2µg/ml laminin-supplemented neural expansion medium (DMEM/F-12 + Glutamax, Gibco®; 1x N-2 supplement, Gibco®; 1x B27 supplement without vitamin A, Gibco®; 10 ng/ml FGF-2, PeproTech; 10 ng/ml EGF, Miltenyi). NPC were then transduced with a VSV-G-pseudotyped lentivirus (carrying pCW57.1 plasmid from Addgene # 41393 (gift from David Root ...
-
bioRxiv - Cell Biology 2020Quote: ... from serial transplants were thawed and maintained in medium (DMEM with 15% FBS + 100 units/ml penicillin streptomycin and 2mM L-glutamine) and supplemented with 10ng/ml IL-3 (Peprotech, 213-13), 10ng/ml IL-6 (Peprotech 216-1 ...
-
bioRxiv - Cell Biology 2022Quote: ... cells were lifted using accutase and plated onto Laminin-111/ poly-L-ornithine-coated plates in NIM supplemented with 10 ng/ml BDNF (Peprotech, 450-02) and 10 ng/ml GDNF (Peprotech ...
-
bioRxiv - Developmental Biology 2021Quote: ... LCDMYI supplementation was added as indicated at the following concentrations: 10 ng ml−1 recombinant human LIF (L, 10 ng ml−1; Peprotech, 300-05), CHIR99021 (C ...
-
bioRxiv - Cell Biology 2020Quote: ... were maintained in medium (RPMI with 20% FBS + 100 units/ml penicillin streptomycin and 2mM L-glutamine) and supplemented with 10ng/ml IL-3 (Peprotech, 213-13). For in vivo experiments ...
-
bioRxiv - Biochemistry 2022Quote: ... cells were diluted to a density of 6e4/mL and 50 μL (3e3 cells) were added to 50 μL of media containing 2x of a serial dilution of human CSF3 (PeproTech 300-23) in a 96-well plate ...
-
bioRxiv - Immunology 2022Quote: ... On day 7 macrophages were harvested and then maintained in 20 ng ml−1 CSF-1 for subsequent experiments in which they were either maintained in medium without any further additions (M0) or with addition of 20 ng ml−1 IL-4 (Peprotech; MI(L-4)) ...
-
bioRxiv - Biochemistry 2022Quote: TNFR2-expressing RamosBlue cells were seeded at 5 × 104 cells/well in 100 μL of medium containing antibodies at the indicated concentrations in the absence or presence of 50 ng/mL TNFα (Peprotech #AF-200-01A). The cells were incubated for 18 h ...