Labshake search
Citations for New England Biolabs :
251 - 300 of 347 citations for pVectOZ GFP Transfection control since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Plant Biology 2019Quote: ... and cloned either alone or under of the 35S promoter together with GFP and mScarlet-i into pPLV03 or pGEX5x3 using Gibson Assembly (NEB). Subsequently ...
-
bioRxiv - Bioengineering 2021Quote: ... the reporter gene GFP was replaced with mScarlet using the NEBuilder HiFi DNA Assembly kit (New England BioLabs catalog number:E5510S), to produce two different expression vectors.
-
bioRxiv - Cell Biology 2021Quote: ... and the later part (RTN4 AA1005-AA1192 plus AcGFP1) of Rtn4a-GFP into the pcDNA3.1(+) backbone using Gibson Assembly (New England Biolabs, #E2611S). Rtn4b-HaloTag was generated by inserting PCR-amplified Rtn4b from Rtn4b-GFP and PCR-amplified HaloTag from pSEMS-Tom20-HaloTag (Addgene plasmid #111135 ...
-
bioRxiv - Cell Biology 2021Quote: ... ∼600-bp homology arms for each target locus were amplified from N2 genomic DNA and then inserted into the GFP^SEC^3xFlag vector pDD282 or the TagRFP^SEC^3xMyc vector pDD286 via Gibson Assembly (New England BioLabs). Hygromycin was used to select the knock-in candidate lines based on the strategy described in Dickinson et al [37].
-
bioRxiv - Neuroscience 2020Quote: ... C-terminal Myc tag of the biosensor and GFP were carried out with Q5 Site-Directed Mutagenesis Kit (New England Biolabs). The plasmid encoding this engineered periplasmic acetylcholine-binding protein (sequence MHHHHHHGGAQPARSANDTVVVGSIIFTEGIIVANMVAEMIEAHTDLKVVRKLNLGGV NVNFEAIKRGGANNGIDIYVEYTGHGLVDILGFPATTDPEGAYETVKKEYKRKWNIVWL KPLGFNNTYTLTVKDELAKQYNLKTFSDLAKISDKLILGATMFFLEGPDGYPGLQKLYN FKFKHTKSMDMGIRYTAIDNNEVQVIDAWATDGLLVSHKLKILEDDKAFFPPYYAAPIIR QDVLDKHPELKDVLNKLANQISLEEMQKLNYKVDGEGQDPAKVAKEFLKEKGLILQVD ...
-
bioRxiv - Biochemistry 2020Quote: ... the truncated CNNM2 PCR products were cloned into the pCINE-IRES-GFP vector by digestion with restriction enzymes NheI (New England Biolabs) and XhoI (New England Biolabs).
-
bioRxiv - Microbiology 2020Quote: ... targeting the C-terminus of the TgPPM3C gene was cloned into the p-HXGPRT-Cas9-GFP plasmid backbone using KLD reactions (New England Biolabs), as previously described [49] ...
-
bioRxiv - Plant Biology 2020Quote: ... The supernatant was collected after a spin at 16000 g for 30 min and incubated with GFP-Trap (Chromtek) or MBP magnetic beads (NEB) for 3 h at 4°C ...
-
bioRxiv - Microbiology 2020Quote: ... pDWV-S-GFP and the parental pDWV-304 were produced using HiScribe T7 High Yield RNA Synthesis Kit (New England Biolabs) according to the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2021Quote: ... An expression clone for the full-length GFP-DdMyo7 with a C-terminal prenylation site (CAAX) was generated using Q5 mutagenesis (New England Biolabs) to add codons encoding the CTLL* prenylation motif from Dictyostelium RasG (UNIPROT ...
-
bioRxiv - Cell Biology 2021Quote: ... The PCR product was assembled into pFA6a-GFP-his3MX6 (Longtine et al., 1998) digested with SalI and PacI (New England BioLabs) using the Gibson Assembly Master Mix (New England BioLabs).
-
bioRxiv - Neuroscience 2022Quote: ... A 7.8 kb cassette that includes 5.2 kb DDX5 promoter sequence and 2.3 kb encoding a DDX5-GFP fusion protein was cloned into pDest-Tol2 vector (Kwan et al., 2007) through Gibson assembly (#E5510, NEB). Gibson assembly primers were designed using NEBuilder Assembly Tool (http://nebuilder.neb.com/) ...
-
bioRxiv - Cell Biology 2022Quote: ... KLC sequences comprising residues 1-155 of murine KLC2 and residues 1-162 or 163-538 of murine KLC1A were amplified by PCR and cloned into the NotI/EcoRI site of the pEL N-term GFP parental vector using Gibson Assembly (New England Biolabs) following the manufacturer’s instructions (Rietdorf et al. ...
-
bioRxiv - Cancer Biology 2022Quote: ... we used Addgene Plasmid #48140 as a transient expression vector backbone by removing Cas9 and GFP with EcoRI-AgeI digestion (NEB), and inserting three overlapping gBlock dsDNA fragments for JAK1 ...
-
bioRxiv - Cell Biology 2020Quote: Full-length TPX2 with N-terminal Strep II-6xHis-GFP-TEV site tags was cloned into pST50Tr-STRHISNDHFR (pST50) vector61 using Gibson Assembly (New England Biolabs). N-terminal 6xHis-tagged ...
-
bioRxiv - Microbiology 2021Quote: ... was PCR-amplified using primers 5’FTL1678_pFNLTP6 and 3’FTL1678_pFNLTP6 (Table S8), the amplicon and pFNLTP6-gro-GFP (Maier, 2004) were double-digested with XhoI and BamHI (New England Biolabs), and ligated using T4 DNA ligase ...
-
bioRxiv - Cell Biology 2020Quote: ... double-strand DNA repair templates were amplified with PCR from the plasmids pSL779 for gfp or pSL780 for mKate2 using Phusion polymerase and the primers listed in table 2 (New England Biolabs) (Bone ...
-
bioRxiv - Microbiology 2021Quote: ... forward and reverse primer for GFP (forward 5’TCGACAGTCAGCCGCATCT3’ and reverse primer 5’CCGTTGACTCCGACCTTCA3’) respectively using 1μl taq polymerase (NEB, USA). The PCR amplification was performed as per the following cycle ...
-
bioRxiv - Cell Biology 2022Quote: SBP-GFP-LAMP1ΔYQTI was PCR amplified from the original backbone SBP-GFP-LAMP11 (a generous gift from Juan Bonifacino, NICHD, NIH, USA) and Gibson assembled (E2621L; New England Biolabs) to the pEGFP-C1 (Clontech ...
-
bioRxiv - Cell Biology 2022Quote: ... and both inserted between the XhoI and EcoRI sites of the parental pLVX N-term GFP vector using Gibson Assembly (New England Biolabs), following the manufacturer’s instructions ...
-
bioRxiv - Genomics 2019Quote: ... designed to be directly cloned into the BbsI or BsaI-digested and dephosphorylated AIO-GFP(Cas9) vector using the Quick Ligation Kit (NEB). The first and second sgRNA was cloned into the BbsI and BsaI sites ...
-
bioRxiv - Cell Biology 2020Quote: ... The AP-3 sorting mutant was regenerated in MigR1-PI4KIIα-GFP using the Q5 site-directed mutagenesis kit (New England Biolabs) following manufacturer’s instructions ...
-
bioRxiv - Synthetic Biology 2021Quote: The pGR plasmid backbone 6 was modified for use in combinatorial assembly by first mutating the gfp stop codons from ‘TAATAA’ to ‘TTAGCA’ using Q5 mutagenesis (E0554S, New England Biolabs) and second replacing the araC gene and PBAD promoter with a consensus T7 promoter sequence (pT7 ...
-
bioRxiv - Microbiology 2021Quote: ... targeting the C- or N-terminus of various genes were cloned into the p-HXGPRT-Cas9-GFP plasmid backbone using KLD reactions (New England Biolabs), as previously described (71) ...
-
bioRxiv - Synthetic Biology 2020Quote: ... inverted PgolB promoter with Bxb1 recognition sites and reporter-terminator (GFP-rrnBT1) pair were amplified by polymerase chain reaction (PCR) using Q5 High-Fidelity DNA Polymerase (M0491, NEB) in thermal cycler (C1000 Touch ...
-
bioRxiv - Genetics 2020Quote: ... This Cas9-P2A-GFP cassette was then cloned into the PE2 expression vector NEBbuilder HIFI assembly mastermix according to manufacturer protocols (NEB). pegRNA were created as previously described (Anzalone et al. ...
-
α-catenin links integrin adhesions to F-actin to regulate ECM mechanosensing and rigidity-dependencebioRxiv - Cell Biology 2021Quote: ... V796A mutations were inserted into the GFP-α-catenin plasmid using the Q5 Site-Directed Mutagenesis Kit (New England Biolabs).
-
bioRxiv - Genetics 2021Quote: ... A second PCR fragment from 24 bp upstream of the GFP start codon to NUP2 (+2482) was generated using the high-fidelity polymerase Phusion (New England Biolabs). The two fragments were joined by overlap extension PCR (Horton 1989 ...
-
bioRxiv - Microbiology 2021Quote: Produce the full-length DWV-GFP in vitro RNA transcript from linearized plasmid DNA template by HiScribe T7 RNA polymerase (New England Biolabs) according to manufacturer’s guidance ...
-
bioRxiv - Microbiology 2020Quote: ... All CRISPR/Cas9 plasmids used in this study were derived from the single-guide RNA (sgRNA) plasmid pSAG1:CAS9-GFP, U6:sgUPRT (Shen, Brown et al. 2014) by Q5 site-directed mutagenesis (New England Biolabs) to alter the 20-nt sgRNA sequence ...
-
bioRxiv - Neuroscience 2020Quote: ... + 5 % non-fat milk for 1 hour at room temperature before incubating with primary antibody: anti-GFP (1:1000, Biolabs) or anti-actin (1:5000 ...
-
bioRxiv - Genetics 2020Quote: ... the ‘T2A-GFP-WPRE’ sequence was amplified from the hVMD2-hBEST1-T2A-GFP plasmid using LCv2-GFP.Gib.F and .R primers and Q5 2X MM (NEB, Cat# M0492L). The ‘2A-Puro-WPRE’ sequence was then removed from the LCv2 plasmid via restriction digestion with PmeI (NEB ...
-
bioRxiv - Molecular Biology 2019Quote: ... and SNAP tag or the GFP sequence followed by the Gateway attR sites was inserted into pCAGEN by NEBuilder HiFi DNA Assembly Master Mix (NEB).
-
bioRxiv - Cell Biology 2019Quote: ... the cDNA of RDGB corresponding to amino acids 947-1259 was subcloned in pJFRC::GFP vector using the restriction enzymes BglII and NotI (NEB). A flexible linker of Gly(G)-Ser(S ...
-
bioRxiv - Bioengineering 2022Quote: ... Emerald GFP was subcloned in-frame downstream of the gvpNJKFGWV ORF via a P2A linker and the entire pNJKFGWV-GFP ORF was subcloned into a pCMVSport backbone with WPRE-hGH-poly(A) elements using NEBuilder HiFi DNA Assembly (NEB). gvpA-IRES-EBFP2-WPRE-hGH polyA was constructed by Gibson assembly of a PCR-amplified IRES-EBFP2 fragment into the XbaI site of gvpA--WPRE-hGH polyA plasmid.
-
bioRxiv - Biochemistry 2022Quote: MBOAT7 mutants were generated by site-directed mutagenesis on the pFBM construct expressing MBOAT7 with a C-terminal GFP and strep tag using the Q5 Mutagenesis Kit (New England Biolabs), according to the manufacturer’s protocol ...
-
bioRxiv - Microbiology 2022Quote: ... from the original pSAG1-Cas9-GFP-UPRT (Shen et al., 2014)) for one targeting the LFM1 locus using the Q5 site-directed mutagenesis kit (NEB). 1 µg of the cassette and 1 µg of Cas9 plasmid were transfected into the LMF1-HA cell line using the Lonza nucleofection system ...
-
bioRxiv - Systems Biology 2023Quote: Mutated or wild type sequences of RORC 3’UTR were cloned into the dual GFP-mCherry reporter using MluI-HF and PacI restriction enzymes (NEB) as described above ...
-
bioRxiv - Neuroscience 2023Quote: ... pJFRC18-8XLexAop2-RGS2(Δ1-53)::CRY2(PHR)::T2A::CIBN::eGFP::CaaX and pJFRC18-8XLexAop2-RGS2(Δ1-53)::CRY2(PHR)(D387A)::T2A::CIBN::eGFP::CaaX were generated by cloning the PiGM cassette into pJFRC18-8XLexAop2-mCD8::GFP 26 cut with XhoI and XbaI (NEB). For zebrafish expression ...
-
bioRxiv - Molecular Biology 2023Quote: ... A CRISPR array containing two repeats and one spacer targeting the gfp gene of recombinant Sindbis virus (SINV-GFP) was generated by annealing and extending two partially complementary DNA oligos with Q5 polymerase (NEB) (Table S1) ...
-
bioRxiv - Cancer Biology 2023Quote: ... 10ng of purified BbsI linearized UniSAM or BsmBI linearized pLV hU6-sgRNA hUbC-dCas9-KRAB-T2a-GFP was ligated with 1 μl of diluted annealed gRNA with 0.5 μl of T4 ligase (New England Biolabs, #M0202L) in a total volume of 10 μl ...
-
bioRxiv - Molecular Biology 2023Quote: ... with GFP protein fused at C- terminal and NcoI restriction enzyme sites on both ends using Gibson Assembly (NEB, USA). Empty vector pCAMBIA 1302 was used as a positive control ...
-
bioRxiv - Synthetic Biology 2023Quote: ... was then done with the homologies to construct the initial green fluorescent protein (GFP) plasmid and then transformed into competent E.coli (NEB#C2984H) and subsequently sequenced (Plasmidsaurus ...
-
bioRxiv - Cancer Biology 2023Quote: ... Cloning into pLV hU6-sgRNA hUbC-dCas9-KRAB-T2a- GFP was performed using BsmBI restriction enzyme (New England Biolabs, #R0580L) as indicated in (Thakore et al ...
-
bioRxiv - Cell Biology 2023Quote: ... The pSS459 plasmid driving the expression of PHOP1-GFP-pch2-nes4A was derived from pSS393 by using the NEBuilder assembly kit (New England Biolabs) and a synthesized gBlock fragment (IDT ...
-
bioRxiv - Biochemistry 2023Quote: ... DNA assembly was performed to join R7-DD and R9-DD to linearised the GFP-cBAK vector using the NEBuilder HiFi DNA assembly kit (NEB).
-
bioRxiv - Genomics 2023Quote: ... The digested gBlock was ligated into the digested pJFRC12-10XUAS-IVS-myr::GFP backbone using the following reactions conditions: 4 µl T4 ligase buffer (10x) (NEB), 20 µl plasmid backbone DNA (0.005 pmol) ...
-
bioRxiv - Developmental Biology 2023Quote: One cell stage AB/TU embryos were injected with 75 pg of smyhc1:gfp plasmid (gift from Stone Elworthy, University of Sheffield, Sheffield, United Kingdom) previously digested with meganuclease ISceI (Biolabs) in order to label slow muscle cells ...
-
bioRxiv - Molecular Biology 2023Quote: ... by replacing the green fluorescent protein (GFP) with a mCherry reporter using the NEBuilding HiFi DNA Assembly Cloning Kit (New England Biolabs) (Ran et al. ...
-
bioRxiv - Plant Biology 2023Quote: ... was cloned in front of the second codon of GFP by Golden Gate cloning (Engler et al., 2008) using BbsI-HF (NEB). Enhancers ...