Labshake search
Citations for New England Biolabs :
251 - 300 of 1294 citations for Mayaro Virus E2 Envelope Protein Mouse Fc tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2019Quote: ... followed by the insertion of a DNA fragment containing C-terminal 2×HA tag by NEBuilder HiFi DNA Assembly Master Mix (NEB). Finally ...
-
bioRxiv - Cell Biology 2019Quote: ... A FLAG-tag (DYKDDDDK tag) followed by a stop codon was then inserted using the Q5 Site-Directed Mutagenesis Kit (New England BioLabs) according to manufacturer protocols ...
-
bioRxiv - Bioengineering 2019Quote: ... inserting a N-terminal TEV cleavage tag and cloned into a pET28a backbone in front of the His-tag using the NEBuilder HiFi DNA assembly method (NEB).
-
bioRxiv - Bioengineering 2019Quote: ... the 720 bp Cerulean cassette between the AgeI/HpaI sites of pPPIA-Cer-Fib was replaced with a 560 bp SNAP tag fragment PCR amplified from plasmid pSNAPf (New England Biolabs) using primer pair Snap-XmaI-For/Snap-HpaI-Fib-Rev and double digested with XmaI/HpaI ...
-
bioRxiv - Biochemistry 2020Quote: Expressed proteins were purified using the intein-mediated purification and affinity chitin-binding tag (IMPACT) chitin affinity matrix system (New England Biolabs). A cell pellet was dissolved in 8 mL of column buffer (20 mM Tris-HCl ...
-
bioRxiv - Cell Biology 2021Quote: ... Plasmids to express Flag-tagged and HA-tagged proteins were created by changing the Myc-coding sequence in pCMV-Myc expression plasmids to intended tag-coding sequence using inverse PCR and NE Builder HiFi Assembly (New England BioLabs), respectively.
-
bioRxiv - Neuroscience 2020Quote: ... C-terminal Myc tag of the biosensor and GFP were carried out with Q5 Site-Directed Mutagenesis Kit (New England Biolabs). The plasmid encoding this engineered periplasmic acetylcholine-binding protein (sequence MHHHHHHGGAQPARSANDTVVVGSIIFTEGIIVANMVAEMIEAHTDLKVVRKLNLGGV NVNFEAIKRGGANNGIDIYVEYTGHGLVDILGFPATTDPEGAYETVKKEYKRKWNIVWL KPLGFNNTYTLTVKDELAKQYNLKTFSDLAKISDKLILGATMFFLEGPDGYPGLQKLYN FKFKHTKSMDMGIRYTAIDNNEVQVIDAWATDGLLVSHKLKILEDDKAFFPPYYAAPIIR QDVLDKHPELKDVLNKLANQISLEEMQKLNYKVDGEGQDPAKVAKEFLKEKGLILQVD ...
-
bioRxiv - Biochemistry 2021Quote: AcpP was expressed from a pET28a plasmid encoding acpP with a thrombin-cleavable N-terminal 6xHis tag in C3031I cells (NEB). 2L cultures of LB supplemented with kanamycin (25 μg/mL ...
-
bioRxiv - Plant Biology 2020Quote: ... and uvr8-17D genotyping was through PCR amplification of a genomic fragment with a forward (5ʹ-TCG GGA TGA GAT GAT GAC-3ʹ) and a reverse primer (5ʹ-TAG ACC CAA CAT TGA CCC-3ʹ) followed by digestion with HaeIII (NEB) yielding diagnostic fragments of 344/173/145 bp for wild type and 489/173 bp for uvr8-17D.
-
bioRxiv - Immunology 2021Quote: ... Two restriction sites NheI at the 5’ end and BamHI at the 3’ end were incorporated into the CD4-polypeptide linker plasmid which was then inserted into pACP-tag(m)-2 plasmid (New England Biolabs) to obtain pACP-CD4 ...
-
bioRxiv - Microbiology 2020Quote: ... A bacteria-codon optimized gBlock for the truncated protein was produced by IDT DNA Technologies and cloned into a pET28a bacterial expression with a C-terminal 6xHis tag using the NEBuilder Assembly Kit (New England Biolabs). Recombinant protein was expressed in BL21(DE3 ...
-
bioRxiv - Microbiology 2019Quote: ... myc epitope tag insertion and TEXEL2 point mutations were introduced into pTub-Gra44-HPT using the Q5 site directed mutagenesis kit (NEB) and TEXEL point mutations were accomplished similarly with Quikchange site-directed mutagenesis kit (Agilent).
-
bioRxiv - Cell Biology 2021Quote: ... and cloned into the pZE13d vector (Lutz and Bujard, 1997) with an N-terminal 6xHis tag via Gibson assembly (Hifi DNA Assembly, NEB) using ClaI and PstI restriction sites ...
-
bioRxiv - Biophysics 2020Quote: ... The construct was amplified by PCR and inserted into pSNAP-tag®(T7)-2 vector (New England Biolabs Inc. #N9181S) with a SNAPf-EGFP-6His cassette ...
-
bioRxiv - Biochemistry 2022Quote: ... open reading frames were cloned into a linearized pET28b vector with BamH1 and Xho1 in frame with a N- terminal 6x-His tag using Gibson HiFi assembly mix (NEB), 10 μL total reaction volume with 2 μL of linearized vector ...
-
bioRxiv - Biophysics 2022Quote: ... 2018) and a C-terminal 6x His tag and cloned into the pET21B vector by Hi-Fi DNA assembly (NEB).
-
bioRxiv - Biochemistry 2022Quote: ... The library was cloned into a pENTR1A plasmid backbone with a C-terminal YFP HA reporter tag using Gibson Assembly (HiFi DNA Assembly Cloning Kit, New England Biolabs, (NEB), Ipswich ...
-
bioRxiv - Microbiology 2022Quote: ... and subsequently modifying the plasmid to add the HA-tag coding sequence using the Q5 Site-Directed Mutagenesis kit (NEB) or the mEos3.2 coding sequence using InFusion (Clontech) ...
-
bioRxiv - Biophysics 2022Quote: ... The DNA fragment was amplified by PCR by inserting a C-terminal 6x His tag and cloned into the pETDUET-1 vector by Hi-Fi DNA assembly (NEB).
-
bioRxiv - Biophysics 2022Quote: SNAP-tag labeling of SNAP-mGluR2 was done by incubating cells with 2 µM of SNAP-Surface Alexa Fluor 549 (NEB) and 2 µM of SNAP-Surface Alexa Fluor 647 (NEB ...
-
bioRxiv - Microbiology 2021Quote: ... The DNA chimera was then cloned into the pACP-tag (m)-2 vector (addgene# 101126) using NheI and NotI (NEB) as the restriction sites ...
-
bioRxiv - Microbiology 2021Quote: ... The repair templates used for the introduction of the C-terminal tags (YFP and SNAP) were amplified by PCR (Q5 polymerase, New England Biolabs) from template plasmids ...
-
bioRxiv - Cell Biology 2020Quote: Full-length TPX2 with N-terminal Strep II-6xHis-GFP-TEV site tags was cloned into pST50Tr-STRHISNDHFR (pST50) vector61 using Gibson Assembly (New England Biolabs). N-terminal 6xHis-tagged ...
-
bioRxiv - Physiology 2020Quote: ... A V5 tag was appended to the C terminus of the open reading frame using Phusion site-directed mutagenesis (New England Biolabs) to generate a V5 tagged version of mouse ANGPTL4 (pHS5) ...
-
bioRxiv - Developmental Biology 2022Quote: ... and zebrafish cachd1 ectodomain production constructs (ectodomain fused to hexahistidine and BirA ligase peptide substrate tags) were prepared by NotI/AscI restriction enzyme double digest (New England Biolabs) of pTT3-based vector backbones (50 ...
-
bioRxiv - Cell Biology 2022Quote: ... was fused to an HA-tag at its N-terminus during PCR and cloned into the lentiviral vector pLJM1 linearized with AgeI (NEB) and EcoRI (NEB ...
-
bioRxiv - Biophysics 2019Quote: ... and 15-25 μM of BG-oligonuculeotides were labeled with ∼ 1 μM myosin II containing a C-terminal SNAP-tag (NEB) in anion-exchange elution buffer for 30 min at room temperature ...
-
bioRxiv - Biophysics 2021Quote: ... and 15–25 μM BG-oligonuculeotides were labeled with ∼1 μM myosin II containing a C-terminal SNAP-tag (NEB) in anion-exchange elution buffer for 30 min at room temperature ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... Cells were labelled with the cleavable SNAP-tag probe BG-S-S-649 (featuring the DY-649 fluorophore, a gift from New England Biolabs) in complete medium for 30 minutes at room temperature ...
-
bioRxiv - Biochemistry 2020Quote: ... 2 mM CaCl2 was added and the His8 tag was cleaved through the addition of 8-16 U/mL enterokinase (New England Biolabs) for 2 days at 37°C ...
-
bioRxiv - Genetics 2021Quote: Plasmid pNR127.9 was constructed by changing the first rfk-1 stop codon in pNR9.1 from TAG to TGG with primer set 1727/1728 and the Q5 Site-Directed Mutagenesis Kit (New England Biolabs). Similarly ...
-
bioRxiv - Microbiology 2021Quote: ... the coding sequence of MS2V5 was removed from pCI-MS2V5-eRF3a F76a plasmid and an N-terminal FLAG tag was inserted to the same plasmid by PCR and re-circularized using NEBuilder HiFi DNA Assembly Master Mix (NEB). The F76a mutation was mutated back to wildtype using In-fusion cloning (Clontech).
-
bioRxiv - Systems Biology 2021Quote: ... the purified DNAs were annealed using random nonamer primers with a 5′-biotin tag (5′-Biotin-CTACACGACGCTCTTCCGATCTNNNNNNNNN-3′) in the presence of Klenow fragments (3′-5′ exo-, New England Biolabs). Then ...
-
bioRxiv - Molecular Biology 2021Quote: To tag the molecular end, HMW genomic DNA (gDNA, see above) was first A-tailed using terminal transferase (NEB M0315) in a reaction by incubating 2ug of gDNA ...
-
bioRxiv - Biochemistry 2022Quote: MBOAT7 mutants were generated by site-directed mutagenesis on the pFBM construct expressing MBOAT7 with a C-terminal GFP and strep tag using the Q5 Mutagenesis Kit (New England Biolabs), according to the manufacturer’s protocol ...
-
bioRxiv - Biophysics 2022Quote: ... a construct was cloned by PCR from the LacZ gene of Escherichia coli MG1655 with a His-tag on the C terminus by Gibson Assembly (New England Biolabs) in a pET-28b vector using the following primers LacZ200 (TAACTTTAAG AAGGAGATAT ACCATGACCA TGATTACGGA TTCACTGGCC GTCGTTTTAC ...
-
bioRxiv - Molecular Biology 2023Quote: ... containing an N-terminal 6xHis tag and TEV site was produced in Escherichia coli NiCo21 (DE3) cells (New England Biolabs) as previously described in https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6069193/ ...
-
bioRxiv - Molecular Biology 2023Quote: ... Supernatant was incubated for 1 h with 50 µL anti-V5-tag mAb-Magnetic beads (#M167-11, MBL) blocked with 1 mg/mL BSA (#B9000S, New England Biolabs). Beads were washed seven times with lysis buffer ...
-
bioRxiv - Microbiology 2022Quote: ... which was assembled with oligo DNA containing Myc or FLAG tag sequence using NEBuilder HiFi DNA Assembly Master Mix (New England Biolabs). The resultant plasmids were named pcDNA3-C-Myc or pcDNA3-C-FLAG ...
-
bioRxiv - Microbiology 2022Quote: ... we amplified the gene ctl0382 (homolog of ct127) with a six histidine tag in the reverse primer using Phusion enzyme (NEB), and the PCR product was linked with pBOMBL::L2 linearized by EagI and KpnI using HiFi assembly system (NEB) ...
-
bioRxiv - Molecular Biology 2022Quote: ... The yrbA-fs15 DNA templates (with TAG or TGA stop codons) used for in vitro transcription/translation reactions in the classic PURExpress system (New England Biolabs) were prepared by PCR ...
-
bioRxiv - Biochemistry 2023Quote: ... following the manufacturer’s protocol and adapting the IMPACT (Intein Mediated Purification with an Affinity Chitin-binding Tag) System (NEB # 6901S). The human eIF2A coding sequence was cloned into the C-terminal Mxe GyrA Intein-chitin-binding domains (CBD ...
-
bioRxiv - Cell Biology 2023Quote: ... pCIG2-SNAP-M87 (generated for this study from pCIG2-GFP-MACF43 by replacing GFP with SNAP-tag from pSNAPf vector (New England Biolabs) and MACF43 with M87 from pCMV-Tag/WT M87) ...
-
bioRxiv - Biochemistry 2023Quote: ... A TEV protease cut site preceding the 6x histidine tag was previously introduced using the Q5 Site-Directed Mutagenesis Kit from NEB and the GeneJET Plasmid Miniprep Kit from ThermoFisher ...
-
bioRxiv - Microbiology 2023Quote: ... encoding a C-terminal myc tag were cloned into NcoI and HindIII sites of pHERD20T-myc and pHERD30T-myc using Gibson Assembly (NEB) or Hifi Assembly (NEB) ...
-
bioRxiv - Microbiology 2023Quote: ... Specific forward primer targeting E1 and a reverse primer targeting the nongenomic tag were used in 20 ul SYBR Green reaction with 1x Luna qPCR Dye (New England Biolabs) according to manufacturer’s instructions ...
-
bioRxiv - Microbiology 2023Quote: ... standard curve transcripts and viral RNA in the samples were reverse transcribed with a reverse E1 primer containing a nongenomic tag sequence74 5’-CAGACAGCACTCGTTCGTACAC-3’ through the Protoscript II First Strand cDNA Synthesis Kit (New England Biolabs). The (+ ...
-
bioRxiv - Biochemistry 2023Quote: ... 250 ng Golden Gate vector (pcDNA3-based carrying a twin Strep-FLAG tag, synthesized by BioCat, Heidelberg, Germany) 2 U BSA HFv2 (NEB), 1 U T4 ligase (NEB ...
-
bioRxiv - Cell Biology 2023Quote: ... with an N-terminal human CD33 signaling peptide and C-terminal 12xHis purification tag was codon optimized and ordered as a gBlocks Gene Fragment (IDT) with overhangs for Gibson assembly (NEB). The sequence was engineered to have a single Cys in the EC5 domain for site-specific labeling as previously described11 ...
-
bioRxiv - Plant Biology 2023Quote: AtXRCC4 fused to a hexa-histidine followed by a GST tag (pGAT3-atxrcc4) was expressed in BL21(DE3) cells (NEB), The proteins were purified using GST sepharose (Cytiva) ...