Labshake search
Citations for New England Biolabs :
101 - 150 of 10000+ citations for Human Procollagen Type III N Terminal Propeptide PIIINP ELISA Kit since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2024Quote: ... and 20 U/μL terminal transferase (NEB, no. M0315S). After incubation at 37°C for 30 min and termination at 70°C for 10 min ...
-
bioRxiv - Molecular Biology 2023Quote: ... and 1U of terminal transferase (New England Biolabs #M0315L). The reaction was incubated at 37°C for five minutes ...
-
bioRxiv - Biochemistry 2024Quote: ... were 3′-labelled using terminal deoxynucleotide transferase (TdT) (NEB), then annealed with the complementary oligonucleotide ...
-
bioRxiv - Biochemistry 2020Quote: ... Human β2AR was fused at its N-terminus to the ACP- or Halo7-tag protein (NEB and Promega, respectively) at the cDNA level ...
-
bioRxiv - Developmental Biology 2021Quote: ... and NEBNext rRNA Depletion Kit (Human/Mouse/Rat) (NEB) according to the manufacturer’s protocol ...
-
bioRxiv - Developmental Biology 2022Quote: ... and NEBNext rRNA Depletion Kit (Human/Mouse/Rat) (NEB) according to the manufacturer’s protocol ...
-
bioRxiv - Biophysics 2021Quote: ... The AcrIIA4 expression vector was modified to express AcrIIA11 with a C-terminal NLS and HA tags using the HiFi Assembly Kit (NEB).
-
bioRxiv - Neuroscience 2020Quote: ... C-terminal Myc tag of the biosensor and GFP were carried out with Q5 Site-Directed Mutagenesis Kit (New England Biolabs). The plasmid encoding this engineered periplasmic acetylcholine-binding protein (sequence MHHHHHHGGAQPARSANDTVVVGSIIFTEGIIVANMVAEMIEAHTDLKVVRKLNLGGV NVNFEAIKRGGANNGIDIYVEYTGHGLVDILGFPATTDPEGAYETVKKEYKRKWNIVWL KPLGFNNTYTLTVKDELAKQYNLKTFSDLAKISDKLILGATMFFLEGPDGYPGLQKLYN FKFKHTKSMDMGIRYTAIDNNEVQVIDAWATDGLLVSHKLKILEDDKAFFPPYYAAPIIR QDVLDKHPELKDVLNKLANQISLEEMQKLNYKVDGEGQDPAKVAKEFLKEKGLILQVD ...
-
bioRxiv - Microbiology 2020Quote: ... A bacteria-codon optimized gBlock for the truncated protein was produced by IDT DNA Technologies and cloned into a pET28a bacterial expression with a C-terminal 6xHis tag using the NEBuilder Assembly Kit (New England Biolabs). Recombinant protein was expressed in BL21(DE3 ...
-
bioRxiv - Biochemistry 2022Quote: ... The library was cloned into a pENTR1A plasmid backbone with a C-terminal YFP HA reporter tag using Gibson Assembly (HiFi DNA Assembly Cloning Kit, New England Biolabs, (NEB), Ipswich ...
-
bioRxiv - Immunology 2023Quote: ... pcDNA3.1-FLAG-ZBTB48 WT was used as template for the generation of the constructs with point mutations in the C-terminal arm using the primers in Table S6 and the Q5 Site-Directed Mutagenesis Kit (NEB). In brief ...
-
bioRxiv - Biophysics 2023Quote: ... The full length KIF5B in pACEBac1 was replaced with a C-terminal TEV-Twin-Strep-tag via HIFI DNA assembly kit (NEB). The TRAK1 construct was made through assembling His-ZZ-TEV-SNAP tag and TRAK1(1-395 ...
-
bioRxiv - Biochemistry 2022Quote: MBOAT7 mutants were generated by site-directed mutagenesis on the pFBM construct expressing MBOAT7 with a C-terminal GFP and strep tag using the Q5 Mutagenesis Kit (New England Biolabs), according to the manufacturer’s protocol ...
-
bioRxiv - Biochemistry 2022Quote: ... and C-terminal truncations (-57Q, -56IQ, -55DIQ and -54DDIQ) were performed on phyg-C-CSNAP-cerulean using the Q5 mutagenesis kit (NEB). HAP1 WT cells were transfected with 5 μg plasmid DNA using JetPRIME (Polyplus) ...
-
bioRxiv - Molecular Biology 2024Quote: PCR products amplifying the C-terminal region of CBP in both edited and unedited cells were cleaned up using the Monarch PCR cleanup kit (NEB). DNA concentrations were measured using the Qubit dsDNA BR kit (ThermoFisher ...
-
bioRxiv - Biochemistry 2024Quote: ... with C-terminal TEV, GFP, 7xHis, and StrepII (Thawani et al., 2020) using the Q5 Site Directed Mutagenesis Kit (NEB). All three constructs were expressed using the Bac-to-Bac Sf9 cell expression system (Invitrogen) ...
-
bioRxiv - Microbiology 2024Quote: ... The library kit and type of sequencer were TruSeq Stranded Total RNA (NEB Microbe) and NovaSeq ...
-
bioRxiv - Synthetic Biology 2024Quote: ... The library kit and type of sequencer were TruSeq Stranded Total RNA (NEB Microbe) and NovaSeq ...
-
bioRxiv - Biochemistry 2020Quote: ... dmGemin2 was fused to a C-terminal Mxe intein (NEB) containing a hexahistidine tag ...
-
bioRxiv - Genomics 2020Quote: ... 1 μl Exonuclease III (NEB), and NEBuffer 1 (NEB ...
-
bioRxiv - Genomics 2020Quote: ... and Exonuclease III (NEB M0206L) for 30 min at 37°C ...
-
bioRxiv - Genetics 2020Quote: ... Exo III ([200U] NEB M0206), Lambda ([20U] NEB M0262] ...
-
bioRxiv - Neuroscience 2021Quote: ... and Heparinase III (NEB P0737S) overnight at 37C ...
-
bioRxiv - Microbiology 2024Quote: ... or III (New England BioLabs) in PBS for 1.5h at 37 C ...
-
bioRxiv - Cell Biology 2024Quote: ... and heparinase III (NEB, P0737S) at 3 U/mL each ...
-
bioRxiv - Biochemistry 2022Quote: ... The library was cloned into a pENTR1A plasmid backbone with a C-terminal YFP HA reporter tag using Gibson Assembly (HiFi DNA Assembly Cloning Kit, New England Biolabs, (NEB), Ipswich ...
-
bioRxiv - Cell Biology 2021Quote: ... were subcloned into phCMV3 to express C-terminal FLAG-tagged CatSper subunits (phCMV3-CatSperd or z-Flag) using NEBuilder® HiFi DNA Assembly Kit (NEB). A stop codon was placed at the upstream of HA-encoding sequences of phCMV3 vector for FLAG-tagged CatSper subunit cloning.
-
bioRxiv - Developmental Biology 2022Quote: Reporter gene fusions for cis-regulatory analysis of terminal identity genes were made using either PCR fusion (Hobert, 2002) or Gibson Assembly Cloning Kit (NEB #5510S). Targeted DNA fragments were fused (ligated ...
-
bioRxiv - Neuroscience 2024Quote: ... C terminal and αPKC binding region) or PICK1 (BAR domain) were made with NEBuilder HiFi DNA Assembly Cloning Kit (NEB #E5520S). Mutations of PICK1 (KD-AA and 5K-E ...
-
bioRxiv - Biophysics 2023Quote: ... PUS1D134A lacking the N-terminal HIS-tag was subcloned into expression vector pET21d (EMD Biosciences) using a Gibson Assembly cloning kit and protocol (NEB # E5510S) and sequence verified ...
-
bioRxiv - Developmental Biology 2023Quote: ... This plasmid was modified to include a C-terminal V5 tag using Q5 Site-Directed Mutagenesis Kit (New England Biolabs, #E0554S). For arnt1-myc ...
-
bioRxiv - Cell Biology 2022Quote: ... and ligated into pcDNA5/FRT/TO-N-FLAG-BirA* using Quick Ligation Kit (NEB). Top10 competent E ...
-
bioRxiv - Microbiology 2024Quote: ... and 1 μL of terminal transferase (20 units, NEB Catalog # M0315S) was added to the reaction with incubation at 37 °C for 1 h to block any pre-existing strand-break sites ...
-
bioRxiv - Microbiology 2024Quote: ... and 1 μL of terminal transferase (20 units, NEB Catalog #M0315S) was added to the reaction with incubation at 37 °C for 1 h to block any pre-existing strand-break sites ...
-
bioRxiv - Pathology 2024Quote: ... A-tailing was conducted using terminal transferase (New England Biolabs M0315S) according to manufacturer specifications in the presence of 10mM 5-Bromo-2’-Deoxyuridine 5’-Triphosphate (BrdUTP ...
-
bioRxiv - Cell Biology 2021Quote: ... and amino-terminal mutants were generated in the hCTR1-p416TEF construct by site-directed mutagenesis using Q5® Site-Directed Mutagenesis Kit (NEB #E0554) protocol ...
-
bioRxiv - Microbiology 2020Quote: ... and one fragment of about 320 bp of the 3’-terminal region by 3’ RACE were amplified using Phusion High-Fidelity PCR Kit (New England Biolabs, MA, USA) under the following conditions [98°C ...
-
bioRxiv - Cancer Biology 2024Quote: ... was purchased from GeneCopia (EX-OL00093-LX304).The C-terminal 11 amino acids were deleted using the Q5® Site-Directed Mutagenesis Kit (New England Biolabs, E0554S). Primers were designed using the NEBase Changer tool to generate the deletion were ...
-
bioRxiv - Genomics 2020Quote: ... then treated with Exonuclease III (NEB) at final conc ...
-
bioRxiv - Genomics 2023Quote: ... Exo I and Exo III (NEB) and incubated at 37°C overnight ...
-
bioRxiv - Molecular Biology 2022Quote: ... or iii) 500U PNGase F (NEB) for 1h at 37°C ...
-
bioRxiv - Microbiology 2022Quote: ... or exonuclease III (NEB, 5 units) were performed on 2 – 3 μg of DNA extracted from virus particles for 1 h at 37 °C ...
-
bioRxiv - Cell Biology 2020Quote: β1-tubulin wild type construct was generated by the gibson assembly (HiFi Kit, New England Biolabs) of a TubB1 sequence fragment synthesised as a gBlock by Integrated DNA Technologies (IDT ...
-
bioRxiv - Microbiology 2023Quote: ... MARCH2 chimeras containing the TM domains from either human MARCH4 or human transferrin receptor (TR) were generated using the NEBuilder HiFi DNA assembly kit (New England Biolabs) and the primers listed in Supplemental Table S2 ...
-
bioRxiv - Microbiology 2020Quote: ... the C-terminal domain was removed by digestion with Endoproteinase LysC (NEB) at a 1:800 LysC:substrate ratio by mass for 1-2h at 37°C ...
-
bioRxiv - Molecular Biology 2024Quote: ... 0.2 mM dCTP and 2 U of terminal transferase (New England Biolabs). The mix was incubated at 37°C for 30 min ...
-
bioRxiv - Genomics 2024Quote: ... and 0.8 U/µL terminal transferase in 1X TdT buffer (NEB #M0315S)) ...
-
bioRxiv - Genomics 2024Quote: ... and 0.4 U/µL terminal transferase in 1X TdT buffer (NEB #M0315S)) for 1 hour at 37°C.
-
bioRxiv - Biochemistry 2024Quote: ... The samples were tailed with poly(dA) using terminal deoxynucleotidyl transferase (NEB) and dATP ...
-
bioRxiv - Molecular Biology 2021Quote: ... Mutations were introduced into UNC-45B wild-type using the Q5® Site-Directed Mutagenesis Kit (NEB). Recombinant protein expression was induced in BL21 DE3 when optical density (OD600 ...