Labshake search
Citations for Millipore Sigma :
3401 - 3450 of 10000+ citations for 6 METHOXY 1 2 3 4 TETRAHYDRO NAPHTHALENE 2 CARBALDEHYDE since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2023Quote: ... and 2 mM glutamine (Sigma), with 2 μg/mL doxycycline (Dox ...
-
bioRxiv - Genomics 2023Quote: ... 0.1 mM 2-mercaptoethanol (Sigma), nonessential amino acids (GIBCO) ...
-
bioRxiv - Molecular Biology 2023Quote: 2-Mercaptoethanol (Sigma Aldrich #M6250).
-
bioRxiv - Immunology 2023Quote: ... 0.1 mM 2-mercaptoethanol (Sigma). Where indicated ...
-
bioRxiv - Developmental Biology 2023Quote: ... + 2% blocking reagent (Sigma 11096176001). Full lengthrfx6.L and pdx1.L anti-sense DIG-labeled in-situ probes were generated using linearized plasmid cDNA templates with 10× DIG RNA labeling mix (Sigma 11277073910 ...
-
bioRxiv - Cancer Biology 2023Quote: ... and 2-ME (Sigma-Aldrich). For in vitro analysis ...
-
bioRxiv - Developmental Biology 2023Quote: ... fibronectin (5µg/cm 2, Sigma) and N-Cadherin (5µg/ml ...
-
bioRxiv - Biochemistry 2023Quote: ... Coli BL21 Rosetta 2 (Novagen), with an additional removable N-terminal His6-Smt-tag (MGHHHHHHGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPL RRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG) ...
-
bioRxiv - Biochemistry 2023Quote: ... 2 mM MgCl2 (Sigma-Aldrich), 10 mM NaCl (Merck) ...
-
bioRxiv - Cancer Biology 2023Quote: ... and 0.001% 2-mercaptoethanol (Sigma) and used immediately for co-culture assays ...
-
bioRxiv - Physiology 2024Quote: ... 2 nM T3 (Sigma-Aldrich) and 10 μg/ml transferrin (Sigma-Aldrich) ...
-
bioRxiv - Systems Biology 2024Quote: ... 2 mM EDTA (Sigma-Aldrich), and 1.2% Triton X-100 (Sigma-Aldrich) ...
-
bioRxiv - Cancer Biology 2024Quote: ... 2 mM L-GLUT (Sigma), 0.1 mM NEAA (Sigma) ...
-
bioRxiv - Biophysics 2024Quote: Guanidine hydrochloride (Sigma, 2 99%), sodium phosphate monobasic dibasic ...
-
bioRxiv - Immunology 2024Quote: ... plus 2-beta mercaptoethanol (Sigma). Blocks were then sealed and homogenized using TissueLyser (Qiagen ...
-
bioRxiv - Immunology 2024Quote: ... 50µM 2-mercaptoethanol (Sigma Aldrich), 100U/ml penicillin and 100µg/ml streptomycin ...
-
bioRxiv - Cell Biology 2024Quote: ... Thymidine (Sigma; T9250, 2 mM), nocodazole (Sigma ...
-
bioRxiv - Neuroscience 2024Quote: ... Holotransferrin (2 mg/ml, Sigma) was added to cells 24 hours after transfection ...
-
bioRxiv - Neuroscience 2024Quote: ... Holotransferrin (2 mg/ml, Sigma) was added to cells 24 hours after transfection ...
-
bioRxiv - Cancer Biology 2024Quote: ... 100 μM 2-mercaptoethanol (Millipore), 0.1 mM Non-Essential Amino-Acids and penicillin/streptomycin (Gibco ...
-
bioRxiv - Cell Biology 2024Quote: ... 2 mM glutamine (Sigma-Aldrich) and 100 µM non-essential amino acids (Thermo-Fisher) ...
-
bioRxiv - Neuroscience 2024Quote: ... 0.055 mM 2-Mercaptoethanol (Sigma) and 4ng/ml of Recombinant Human FGF (R&D Systems) ...
-
bioRxiv - Biochemistry 2024Quote: ... 2 µM DSM1 (Sigma, 53330401), or 6 µM blasticidin-S (Invitrogen ...
-
bioRxiv - Neuroscience 2024Quote: ... 2 mM thiourea (Sigma, #T8656), 5 mM Na-ascorbate (Sigma ...
-
bioRxiv - Neuroscience 2024Quote: ... 100 μM 2-Mercaptoethanol (Sigma), 10 ng/mL human FGF-basic (PeproTech ...
-
bioRxiv - Cancer Biology 2024Quote: ... or 2 mM glutamine (Sigma) for glycolysis bioenergetics assay ...
-
bioRxiv - Cell Biology 2024Quote: ... Hydroxyurea (Sigma, H8627, 2 mM), Centrinone (MedChem Express ...
-
bioRxiv - Neuroscience 2024Quote: ... 2 mM thiourea (Sigma, #T8656), 5 mM Na-ascorbate (Sigma ...
-
bioRxiv - Neuroscience 2024Quote: ... 0.5 ml 2-propanol (Sigma) was added ...
-
bioRxiv - Cancer Biology 2024Quote: ... 50mmol/L 2-mercaptoethanol (Sigma) with 2mmol/L L-glutamine (ThermoFisher ...
-
bioRxiv - Cell Biology 2024Quote: ... 10 µM 2-mercaptoethanol (Sigma), and penicillin (100 units/mL)-streptomycin (100 µg/mL ...
-
bioRxiv - Biophysics 2024Quote: ... and 2% bisacrylamide (Sigma-Aldrich) as given in Supplementary Table 1 ...
-
bioRxiv - Microbiology 2024Quote: ... 2 mL/L glycerol (Sigma), 2 mL/L oleic acid (technical grade ...
-
bioRxiv - Microbiology 2024Quote: ... 2 U of Benzonase (Novagen), 0.2 U of Phosphodiesterase I (Worthington) ...
-
bioRxiv - Molecular Biology 2024Quote: ... 2 mM GlutaMAX (Sigma, G8541), non-essential amino acid solution (Gibco ...
-
bioRxiv - Bioengineering 2024Quote: ... 2 wt.% borax (Sigma-Aldrich) was added to the hydrogel mixture to initiate borate crosslinking ...
-
bioRxiv - Evolutionary Biology 2024Quote: ... and 2% glucose (Sigma-Aldrich) for 24-48 hr at 30 °C ...
-
bioRxiv - Immunology 2024Quote: ... 50µM 2-mercaptoethanol (Sigma Aldrich), 100U/ml penicillin and 100µg/ml streptomycin ...
-
bioRxiv - Microbiology 2024Quote: ... 2 mM L-glutamine (Sigma), 15 mM HEPES (Sigma) ...
-
bioRxiv - Cell Biology 2024Quote: ... 2 mM malate (M1000, Sigma), and 5 mM NaCl (S9888 ...
-
bioRxiv - Systems Biology 2024Quote: ... 2 mM Mg2SO4 (Sigma Aldrich), 0.1 mM CaCl2 (Sigma Aldrich) ...
-
bioRxiv - Cell Biology 2024Quote: ... 2 mM glutamine (Sigma-Aldrich) and 100 µM non-essential amino acids (Thermo-Fisher ...
-
bioRxiv - Neuroscience 2024Quote: ... 2 μM AraC (C1768, Sigma) was added to the medium from day six until the end of the differentiation ...
-
bioRxiv - Neuroscience 2024Quote: ... 2 µg/mL Heparin (Sigma) on poly-D-lysine (Sigma) ...
-
bioRxiv - Immunology 2024Quote: ... 2-DG 50 mM (Sigma). Growth media was exchanged with XF DMEM medium ...
-
bioRxiv - Neuroscience 2019Quote: ... and 100 μM 4-(3-butoxy-4-methoxybenzyl) imidazolidone (Ro 20-1724, Sigma-Aldrich)) ...
-
bioRxiv - Developmental Biology 2020Quote: ... These were washed in collection medium (6:4 M199 (Sigma M7653)) ...
-
bioRxiv - Developmental Biology 2021Quote: ... These were passaged every 4-6 days with Accutase (#A6964; Sigma) for 8-10 minutes ...
-
bioRxiv - Animal Behavior and Cognition 2022Quote: ... Chemical compounds were first identified using the NIST library and later confirmed with co-elution of synthetic 4-methyl-3-heptanone (Pfaltz and Bauer M19160) and 4-methyl-3-heptanol (Sigma Aldrich M48309). Compounds eluting after 30 minutes were excluded from the analysis due to lack of volatility.
-
bioRxiv - Bioengineering 2021Quote: ... and (3) 4- methylmorpholine (4.5 equiv:ELP amine; Sigma, M56557). The reagents are dissolved at room temperature (RT ...