Labshake search
Citations for Millipore Sigma :
2801 - 2850 of 10000+ citations for NKX2 4 Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2022Quote: ... followed by 4 % paraformaldehyde (PFA, Sigma, P6148). Brains were harvested and post-fixed in 4 % PFA overnight at 4 °C ...
-
bioRxiv - Developmental Biology 2022Quote: ... organoids were fixed in 4% paraformaldehyde (Sigma) for 1 h at room temperature (RT) ...
-
bioRxiv - Cancer Biology 2022Quote: ... and then fixed in 4% paraformaldehyde (Sigma) overnight at 4°C ...
-
bioRxiv - Cell Biology 2022Quote: ... 4′,6-Diamidino-2-phenylindole (DAPI, Sigma) was used to stain cell nuclei ...
-
bioRxiv - Cell Biology 2022Quote: ... 4 µM antimycin A (Sigma, Cat#A8674), 30 mM 2-deoxy-glucose (Tokyo Kasei ...
-
bioRxiv - Cell Biology 2022Quote: ... or NHS-dPEG®4-biotin (Sigma), the same steps were followed as RMA purification until pelleted filamentous actin was homogenized and sonicated ...
-
bioRxiv - Developmental Biology 2022Quote: ... 10 mM 4-Phenylbutyric acid (Sigma Aldrich), or 1mg/mL Tunicamycin (Calbiochem/EMD Chemicals ...
-
bioRxiv - Cell Biology 2022Quote: ... and 4 mM sodium ascorbate (Sigma #PHR1279) were added to the samples and these were rotated for 16-20 h at room temperature ...
-
bioRxiv - Cell Biology 2022Quote: ... and 4 μg/ml laminin (Sigma-Aldrich) coated culture dishes ...
-
bioRxiv - Neuroscience 2021Quote: ... propionic acid (Sigma CAS #79-09-4), 1,4-diaminobutane (Sigma CAS #110-60-1) ...
-
bioRxiv - Neuroscience 2021Quote: ... ethyl butyrate (Sigma CAS #105-54-4), hexanol (Sigma CAS #111-27-3) ...
-
bioRxiv - Immunology 2020Quote: ... 4 g of P123 (Sigma-Aldrich, USA) surfactant (average Mn ∼5,800 ...
-
bioRxiv - Pathology 2021Quote: ... 4-Hydroxytamoxifen Ready Made Solution (Sigma, SML1666) was added into the culture medium (1:1000 ...
-
bioRxiv - Developmental Biology 2021Quote: ... cells were fixed in 4% paraformaldehyde (Sigma) for 1 h at room temperature (RT ...
-
bioRxiv - Molecular Biology 2020Quote: ... 4 g KCl (Sigma-Aldrich 746436-500G), 9.6 g KH2PO4 (Sigma-Aldrich P0662-500G) ...
-
bioRxiv - Neuroscience 2020Quote: ... followed by 4% paraformaldehyde (PFA) (Sigma-Aldrich) solution in 0.1 M phosphate buffer (PB ...
-
bioRxiv - Microbiology 2021Quote: Cells were fixed with PFA 4% (Sigma) during 20min ...
-
bioRxiv - Cancer Biology 2020Quote: ... Cells were fixed with 4% PFA (Sigma) for 10mins ...
-
bioRxiv - Neuroscience 2021Quote: ... 25μl of 5mM 4-MU (Sigma, M3633) were added and immediately incubated for 25 min at 37°C ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-aquaporin 4 (Sigma, A5971, 1:500), anti-ephb4 (R&D Systems ...
-
bioRxiv - Neuroscience 2022Quote: ... iPSCs were fixed with 4% PFA (Sigma) at room temperature for 15 min ...
-
bioRxiv - Molecular Biology 2022Quote: ... dissolved in 4% carboxymethylcellulose (CMC, Sigma-Aldrich) with 1.25% chloroform (Beijing Chemical Works ...
-
bioRxiv - Microbiology 2022Quote: ... fixed in 4% paraformaldehyde solution (Sigma-Aldrich) for 20 min ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: ... plates were centrifuged (Sigma Model 4-16S) at 6000 rpm for 2 minutes ...
-
bioRxiv - Biochemistry 2019Quote: ... 4% D-glucose (w/v) (Sigma Aldrich), 1× MEM Vitamin solution (100× solution ...
-
bioRxiv - Neuroscience 2022Quote: ... and 4-AP (100 µM; Sigma-Aldrich) in the aCSF.
-
bioRxiv - Cell Biology 2022Quote: ... activated (clone HUTS-4, MAB2079-AF488 Millipore); rabbit polyclonal anti-mouse PTRF (Abcam) ...
-
bioRxiv - Microbiology 2022Quote: ... ice-cold 4% formaldehyde (Sigma, CN 47608) in 1x PBS and incubated with shaking overnight at 4 °C (Digital Platform Rocker Shaker ...
-
bioRxiv - Neuroscience 2022Quote: ... 3 mg of 4-OHT (Sigma H7904) were dissolved in 120μl of ethanol ...
-
bioRxiv - Neuroscience 2019Quote: ... 4% paraformaldehyde (from SIGMA-ALDRICH Cat.no. P6148) in 0.1 M phosphate-buffered saline at 4°C for at least 72h ...
-
bioRxiv - Developmental Biology 2019Quote: ... fixed for 6h in 4% paraformaldehyde (Sigma) and washed with 70% ethanol according to pathology platform standard protocols ...
-
bioRxiv - Neuroscience 2019Quote: ... and biocytin (Sigma-Aldrich, #B4261; 4 mM) were added to the internal solution to aid in morphological reconstruction and post-hoc confirmation of cell location ...
-
bioRxiv - Biochemistry 2019Quote: ... 1 mM 4-nitrobenzylalcohol (NBA, Sigma-Aldrich), 1.5 mM 6-hydroxy-2,5,7,8-tetramethyl-chromane-2-carboxylic acid (Trolox ...
-
bioRxiv - Cell Biology 2019Quote: ... supplemented with polybrene (4 μg/mL, Sigma) and applied to Tp53-knockout WT cells or PP2A-AαP179R/+ cells ...
-
bioRxiv - Bioengineering 2019Quote: ... Coverslips were fixed with 4% PFA (Sigma), washed with PBS ...
-
bioRxiv - Plant Biology 2019Quote: ... 1% 4-dimethylaminobenzaldehyde (1.2 ml, DMAB, Sigma) was added ...
-
bioRxiv - Neuroscience 2019Quote: ... or 4 mM L-Methionine (Sigma-Aldrich) and in parallel stimulated with 100 µM DHPG or vehicle for 5 minutes at 37°C/5% CO2 ...
-
bioRxiv - Physiology 2019Quote: ... Exendin-4 was purchased from Sigma-Aldrich. Labelled exendin-9 (DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC(Cy3)-NH2 ...
-
bioRxiv - Physiology 2019Quote: ... alone or with exendin-4 (Sigma-Aldrich) added at the indicated concentrations ...
-
bioRxiv - Cancer Biology 2019Quote: ... then coverslipped with Mowiol 4-88 (Sigma).
-
bioRxiv - Cancer Biology 2020Quote: ... Propidium iodide (Sigma-Aldrich, 25535-16-4), FITC Annexin V Apoptosis Detection Kit (BD Biosciences) ...
-
bioRxiv - Molecular Biology 2020Quote: ... N-acetylcystein (NAC; Sigma A9165, 4 mM) and potassium bromate (KBrO3 ...
-
bioRxiv - Bioengineering 2021Quote: Cells were fixed with 4% formaldehyde (Sigma) for 15 min at room temperature ...
-
bioRxiv - Cancer Biology 2019Quote: ... then coverslipped with Mowiol 4-88 (Sigma). Slides were scanned using a Zeiss Axio Slide Scanner and images were analyzed using HALO software (Indica Labs).
-
bioRxiv - Immunology 2020Quote: ... and Polybrene (4 μg/ml; Merck Millipore) in a total volume of 7 ml (2 ml of a 15-min-preincubated transfection mix in serum-free DMEM added to 5 ml of fresh full DMEM) ...
-
bioRxiv - Developmental Biology 2020Quote: ... fixed in 4% paraformaldehyde (PFA) (Sigma #P6148) in PBS and processed for in situ hybridization ...
-
bioRxiv - Developmental Biology 2020Quote: ... fixed in 4% paraformaldehyde (PFA, Sigma P6148) in PBS overnight at 4°C at 4 dpf then stored in 100% MeOH at –20°C until processed for RNA in situ hybridization ...
-
bioRxiv - Microbiology 2021Quote: ... supplemented with 4 ug/mL polybrene (Sigma) for 6 hours ...
-
bioRxiv - Immunology 2020Quote: ... and 4 μg/mL DNase I (Sigma) in HBSS at 37°C for 1 h and 15 min with periodic vortex every 20 min ...
-
bioRxiv - Physiology 2019Quote: ... carbonyl cyanide 4-trifluoromethoxyphenylhydrazone (FCCP) (Sigma, C2920), in 0.05% ethanol E3 medium ...