Labshake search
Citations for Millipore Sigma :
2801 - 2850 of 10000+ citations for Integrin alpha 4 Rabbit Recombinant mAb since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2022Quote: ... ice-cold 4% formaldehyde (Sigma, CN 47608) in 1x PBS and incubated with shaking overnight at 4 °C (Digital Platform Rocker Shaker ...
-
bioRxiv - Neuroscience 2022Quote: ... 3 mg of 4-OHT (Sigma H7904) were dissolved in 120μl of ethanol ...
-
bioRxiv - Neuroscience 2019Quote: ... 4% paraformaldehyde (from SIGMA-ALDRICH Cat.no. P6148) in 0.1 M phosphate-buffered saline at 4°C for at least 72h ...
-
bioRxiv - Developmental Biology 2019Quote: ... fixed for 6h in 4% paraformaldehyde (Sigma) and washed with 70% ethanol according to pathology platform standard protocols ...
-
bioRxiv - Neuroscience 2019Quote: ... and biocytin (Sigma-Aldrich, #B4261; 4 mM) were added to the internal solution to aid in morphological reconstruction and post-hoc confirmation of cell location ...
-
bioRxiv - Biochemistry 2019Quote: ... 1 mM 4-nitrobenzylalcohol (NBA, Sigma-Aldrich), 1.5 mM 6-hydroxy-2,5,7,8-tetramethyl-chromane-2-carboxylic acid (Trolox ...
-
bioRxiv - Cell Biology 2019Quote: ... supplemented with polybrene (4 μg/mL, Sigma) and applied to Tp53-knockout WT cells or PP2A-AαP179R/+ cells ...
-
bioRxiv - Bioengineering 2019Quote: ... Coverslips were fixed with 4% PFA (Sigma), washed with PBS ...
-
bioRxiv - Plant Biology 2019Quote: ... 1% 4-dimethylaminobenzaldehyde (1.2 ml, DMAB, Sigma) was added ...
-
bioRxiv - Neuroscience 2019Quote: ... or 4 mM L-Methionine (Sigma-Aldrich) and in parallel stimulated with 100 µM DHPG or vehicle for 5 minutes at 37°C/5% CO2 ...
-
bioRxiv - Physiology 2019Quote: ... Exendin-4 was purchased from Sigma-Aldrich. Labelled exendin-9 (DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC(Cy3)-NH2 ...
-
bioRxiv - Physiology 2019Quote: ... alone or with exendin-4 (Sigma-Aldrich) added at the indicated concentrations ...
-
bioRxiv - Cancer Biology 2019Quote: ... then coverslipped with Mowiol 4-88 (Sigma).
-
bioRxiv - Cancer Biology 2020Quote: ... Propidium iodide (Sigma-Aldrich, 25535-16-4), FITC Annexin V Apoptosis Detection Kit (BD Biosciences) ...
-
bioRxiv - Molecular Biology 2020Quote: ... N-acetylcystein (NAC; Sigma A9165, 4 mM) and potassium bromate (KBrO3 ...
-
bioRxiv - Bioengineering 2021Quote: Cells were fixed with 4% formaldehyde (Sigma) for 15 min at room temperature ...
-
bioRxiv - Cancer Biology 2019Quote: ... then coverslipped with Mowiol 4-88 (Sigma). Slides were scanned using a Zeiss Axio Slide Scanner and images were analyzed using HALO software (Indica Labs).
-
bioRxiv - Immunology 2020Quote: ... and Polybrene (4 μg/ml; Merck Millipore) in a total volume of 7 ml (2 ml of a 15-min-preincubated transfection mix in serum-free DMEM added to 5 ml of fresh full DMEM) ...
-
bioRxiv - Developmental Biology 2020Quote: ... fixed in 4% paraformaldehyde (PFA) (Sigma #P6148) in PBS and processed for in situ hybridization ...
-
bioRxiv - Developmental Biology 2020Quote: ... fixed in 4% paraformaldehyde (PFA, Sigma P6148) in PBS overnight at 4°C at 4 dpf then stored in 100% MeOH at –20°C until processed for RNA in situ hybridization ...
-
bioRxiv - Microbiology 2021Quote: ... supplemented with 4 ug/mL polybrene (Sigma) for 6 hours ...
-
bioRxiv - Immunology 2020Quote: ... and 4 μg/mL DNase I (Sigma) in HBSS at 37°C for 1 h and 15 min with periodic vortex every 20 min ...
-
bioRxiv - Physiology 2019Quote: ... carbonyl cyanide 4-trifluoromethoxyphenylhydrazone (FCCP) (Sigma, C2920), in 0.05% ethanol E3 medium ...
-
bioRxiv - Microbiology 2019Quote: ... and 4’,6-diamidino-2-phenylindole (Sigma) (DAPI ...
-
bioRxiv - Cell Biology 2019Quote: ... cells were fixed in 4% paraformaldehyde (Sigma), washed by PBS and mounted by AntiFade mounting medium (containing 2 μg/mL DAPI ...
-
bioRxiv - Immunology 2019Quote: ... FITC-labeled dextran (Sigma-Aldrich, 4 kDa) was to the apical surface at a final concentration of 2 mg/mL ...
-
bioRxiv - Developmental Biology 2021Quote: Embryos were fixed in 4% PFA (Sigma) in PBS for 1.5 hours at 4°C and equilibrated in 30% sucrose (Fisher Scientific ...
-
bioRxiv - Physiology 2021Quote: ... [25μg/ml Bleomycin (Sigma # 9041-93-4), 5%DSS (Sigma ...
-
Myofiber injury induces capillary disruption and regeneration of disorganized microvascular networksbioRxiv - Physiology 2021Quote: ... and 4% normal goat serum (#50197Z, Sigma) in PBS ...
-
bioRxiv - Neuroscience 2021Quote: ... followed by 4% paraformaldehyde (P6148, Sigma Aldrich). The brain was extracted and post-fixed in 4% PFA for 24 hours ...
-
bioRxiv - Neuroscience 2020Quote: ... L-Valine (Sigma-Aldrich, 72-18-4), L-Cysteine (Sigma-Aldrich ...
-
bioRxiv - Neuroscience 2020Quote: ... L-Tyrosine (Sigma-Aldrich, 60-17-4), L-Threonine (Sigma-Aldrich ...
-
bioRxiv - Cell Biology 2021Quote: ... 4×104 monothioglycerol (MTG, Sigma-Al-drich), 50 µg/ml ascorbic acid (Sigma-Aldrich) ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... and 4% (w/v) sucrose (Sigma #S0389). Cells were then washed once with D-PBS for 10 min and permeabilized for 30 minutes with D-PBS containing 0,2% (v/v ...
-
bioRxiv - Developmental Biology 2020Quote: ... 4 mM Magnesium Chloride (Sigma-Aldrich, M1028) and 1 mM EGTA (Fisher Scientific ...
-
bioRxiv - Biophysics 2021Quote: ... 4 mM protocatechuic acid (PCA) (Sigma-Aldrich) and 100 nM protocatechuate 3,4-dioxygenase (PCD ...
-
bioRxiv - Cell Biology 2020Quote: ... 4-hydroxytamoxifen was purchased from Sigma (#H6278) and SAG was purchased from Abcam (#ab142160) ...
-
bioRxiv - Cell Biology 2020Quote: ... and Polybrene (4 μg/ml) (Sigma-Aldrich) and incubated overnight at 37°C ...
-
bioRxiv - Microbiology 2020Quote: ... Cells were fixed with 4% paraformaldehyde (Sigma), washed with PBS ...
-
bioRxiv - Neuroscience 2020Quote: ... followed by 4% paraformaldehyde (Sigma-Aldrich Inc) in 0.01 M PBS ...
-
bioRxiv - Microbiology 2021Quote: ... fixed in 4% paraformaldehyde/PBS (Sigma-Aldrich) for 15 min at room temperature ...
-
bioRxiv - Cell Biology 2021Quote: ... MOWIOL 4-88 (Calbiochem, Merck-Millipore, UK) mounting media was used in combination with 1 μg·mL-1 DAPI in PBS (Thermo Fisher Scientific ...
-
bioRxiv - Genetics 2019Quote: ... and 4 ug/ml laminin (Sigma-Aldrich). Cells were maintained in a 5% CO2 atmosphere at 37°C ...
-
bioRxiv - Immunology 2020Quote: ... and chromogenic substrate 4-nitrophenyl phosphate (Sigma). Purified monoclonal antibodies (B1-8μ and 18-1-16y1 ...
-
bioRxiv - Neuroscience 2022Quote: ... followed by 4% paraformaldehyde (PFA, Sigma, P6148) in PBS for 15 min.
-
bioRxiv - Developmental Biology 2022Quote: ... 4 mM Tubacin (Sigma Aldrich cat. #SML0065) dissolved in DMSO ...
-
bioRxiv - Developmental Biology 2022Quote: ... aggregates were fixed with 4% paraformaldehyde (Sigma) in PBS for 2 h at room temperature ...
-
bioRxiv - Biophysics 2022Quote: ... samples were fixed in 4% paraformaldehyde (Sigma) and blocked with 2% BSA Sigma) ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... cells were fixed with 4% paraformaldehyde (Sigma) in PBS for 10 min at room temperature ...
-
bioRxiv - Cell Biology 2022Quote: ... 4′,6-diamidino-2-phenylindole (DAPI, Sigma). High-content images were acquired with the Cytation3 (Bioteck ...