Labshake search
Citations for Millipore Sigma :
1901 - 1950 of 10000+ citations for Suppressor of CDC2 With RNA Binding Motif 2 RBMS1 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Genomics 2024Quote: ... 2 mM EDTA (Sigma, E7889) in PBS) ...
-
bioRxiv - Genomics 2024Quote: ... 2 mM EDTA (Sigma, E7889) in PBS) ...
-
bioRxiv - Genomics 2024Quote: ... 50uM 2-beta mercaptoethanol (Sigma), 10mM nicotinamide (SIGMA) ...
-
bioRxiv - Immunology 2024Quote: ... and 2 µM ionomycin (Sigma), 10 ng/mL recombinant IL-33 (Biolegend) ...
-
bioRxiv - Cancer Biology 2023Quote: ... 50 nM 2-mercaptoethanol (Sigma), 30 ng/ml EGF (Novoprotein) ...
-
bioRxiv - Bioengineering 2024Quote: ... NaOH (2 M, Sigma Aldrich) in a concentration 0.4 mmol gram-1 of gelatin ...
-
bioRxiv - Cancer Biology 2024Quote: ... supplemented with 2% FBS (Sigma) for 20 min at 4°C ...
-
bioRxiv - Cell Biology 2024Quote: ... 2 μM Gö6983 (Sigma- Aldrich), and 10 ng/mL LIF ...
-
bioRxiv - Immunology 2023Quote: ... 100 nM 2-APB (Sigma), 10 μM BTP2 (Merk Millipore) ...
-
bioRxiv - Microbiology 2023Quote: ... ActD: 2 µg/ml (Sigma), Shield1 ...
-
bioRxiv - Neuroscience 2023Quote: ... 2 mM EDTA (Sigma-Aldrich) and 10 µg/mL insulin (Sigma-Aldrich) ...
-
bioRxiv - Neuroscience 2023Quote: Risperidone (Sigma, 106266-06-2) dissolved in saline (lactated ringer ...
-
bioRxiv - Biochemistry 2023Quote: ... Coli BL21 Rosetta 2 (Novagen), with an additional N-terminal MBP-and C-terminal His6-tag (MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIA YPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWP LIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIA EAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGI NAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAAT MENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAAS EFSSNNNNNNNNNNLGIEGRMATLEKLMKAFESLKSFQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQP PPQAQPLLPQPQPPPPPPPPPPGPAVAEEPLHRPSGSHHHHHH) ...
-
bioRxiv - Genetics 2022Quote: ... 2 IU/ml heparin (Sigma), 5% human AB serum (Eurobio AbCys) ...
-
bioRxiv - Developmental Biology 2023Quote: ... 2 and 3 (Sigma-Aldrich). The homogenate was sheared through a 26-gauge needle and sonicated three times for 20-second bursts ...
-
bioRxiv - Immunology 2023Quote: ... 50uM 2-mercaptoethanol (Sigma-Aldrich) and 1% penicillin/streptomycin (Sigma-Aldrich).
-
bioRxiv - Neuroscience 2023Quote: ... and collagenase type 2 (Sigma), then mechanical dissociated by trituration ...
-
bioRxiv - Microbiology 2023Quote: ... 2 mM MgSO4 (Sigma Aldrich), 0.1 mM CaCl2 (Sigma Aldrich) ...
-
bioRxiv - Developmental Biology 2022Quote: ... 2-mM L-glutamine (Sigma), and 5.0 mg/mL of Folltropin (Vetoquinol) ...
-
bioRxiv - Neuroscience 2023Quote: ... CaCl2 (2 mM, Sigma-Aldrich), NaH2PO4 (1.2 mM ...
-
bioRxiv - Neuroscience 2023Quote: ... MgCl2 (2 mM, Sigma-Aldrich); CaCl2 (2 mM ...
-
bioRxiv - Cancer Biology 2023Quote: ... Thapsigargin (Sigma; 0.1-2 μM), Tunicamycin (Sigma ...
-
bioRxiv - Plant Biology 2023Quote: ... coli BL21 Rosetta 2 (Novagen) were transformed with the pETDuet SEP375–178 /AG90–189 construct and grown either in LB or minimal medium containing selenomethionine as described49 ...
-
bioRxiv - Immunology 2023Quote: ... 2 nM PS341 (Sigma #504314), and 30 ng/ml mouse IFNβ (R&D Systems #8234-MB-010)
-
Neuron-astrocyte metabolic coupling facilitates spinal plasticity and maintenance of persistent painbioRxiv - Neuroscience 2022Quote: ... 2 mM DTT (Sigma, 10197777001), 100 U/ml RNasin (Promega ...
-
bioRxiv - Developmental Biology 2022Quote: ... 2 μM Forskolin (Sigma, F3917) and 4% KSR (Invitrogen ...
-
bioRxiv - Cancer Biology 2022Quote: ... and 2 (Sigma; Cat# P0044), and 1× phenylmethanesulfonyl fluoride (Sigma ...
-
bioRxiv - Genetics 2022Quote: ... 2 μL Flag (Sigma, F1804) or 1 μL WC-2 antibody (Cheng ...
-
bioRxiv - Microbiology 2023Quote: ... 2 mM MβCD (Sigma-Aldrich) or 40 mM Los (Sigma-Aldrich ...
-
bioRxiv - Microbiology 2023Quote: ... and 2-oxoadipate (75447, Sigma) were used as chemical standards ...
-
bioRxiv - Cancer Biology 2023Quote: ... and 5% 2-mercaptoethanol (Sigma), and incubated at room temperature instead of boiled ...
-
bioRxiv - Cancer Biology 2023Quote: ... ERK1/2 (05-157, Millipore), STAT3 (610190 ...
-
bioRxiv - Neuroscience 2023Quote: ... containing 1% 2-mercaptoethanol (Sigma) to be able to use for RNA extraction.
-
bioRxiv - Synthetic Biology 2023Quote: ... 2 mM MgSO4 (Sigma-Aldrich), 0.1 mM CaCl2 (Sigma-Aldrich) ...
-
bioRxiv - Genomics 2023Quote: ... 2% BSA (Sigma-Aldrich, SRE0036) in PBS ...
-
bioRxiv - Genomics 2023Quote: ... 2% BSA (Sigma-Aldrich, SRE0036) in PBS) ...
-
bioRxiv - Genomics 2023Quote: ... 2% BSA (Sigma-Aldrich, SRE0036) in PBS ...
-
bioRxiv - Neuroscience 2023Quote: ... 2 mM trolox (238813, Sigma), 50 μM trolox quinone ...
-
bioRxiv - Neuroscience 2023Quote: ... and 2 µM DAPT (Sigma)) ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... 2 mM glutamine (Sigma Aldrich), 100 units/ml penicillin (Sigma Aldrich ...
-
bioRxiv - Neuroscience 2023Quote: ... 2 M NaCl (Sigma Aldrich) in PBS (control) ...
-
bioRxiv - Neuroscience 2023Quote: ... 0.035% 2-mercaptoethanol (Sigma- Aldrich). Three or four days later the medium was exchanged with organoid differentiation medium with vitamin A and the plates were transferred to an orbital shaker set to 30 rpm inside the incubator ...
-
bioRxiv - Neuroscience 2023Quote: ... 0.1mM 2-mercaptoethanol (Sigma-Aldrich). 12,000 cells in 150µL organoid formation medium/well were reaggregated in low attachment 96-well plates (Corning ...
-
bioRxiv - Neuroscience 2023Quote: ... or 2 uM CCCP (Sigma) for 3.5 hours ...
-
bioRxiv - Neuroscience 2023Quote: ... phosphatase inhibitor cocktail 2 (Sigma) and phosphatase inhibitor cocktail 3 (Sigma) ...
-
bioRxiv - Immunology 2023Quote: ... supplemented with 2-mercaptoethanol (Sigma) and stored on dry ice before storage at −80°C for subsequent RNA extraction.
-
bioRxiv - Genetics 2023Quote: ... 2% glutamine (Sigma-Aldrich #G7513) and 1% Pen-Strep (Sigma-Aldrich #P0781) ...
-
bioRxiv - Neuroscience 2023Quote: ... phosphatase inhibitor cocktail 2 (Sigma) and phosphatase inhibitor cocktail 3 (Sigma) ...
-
bioRxiv - Systems Biology 2023Quote: ... 2 M thiourea (Sigma-Aldrich), and 10 mM HEPES at pH 8 ...
-
bioRxiv - Systems Biology 2023Quote: ... 2 µM cytosine arabinoside (Sigma) were added at day 3 for 24 h to avoid glial proliferation ...