Labshake search
Citations for Addgene :
751 - 800 of 804 citations for Hantaan Virus Nucleoprotein HEK293 His tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2023Quote: ... SNAP-Rab7A and SNAP-Rab7A Q67L were made by cloning Rab7A sequence from EGFP-Rab7A and EGFP-Rab7A Q67L plasmids into pSNAP-tag (m) Vector (Addgene #101135). Soluble BFP (mTagBFP2 ...
-
bioRxiv - Biochemistry 2023Quote: ... The codon optimized AOX with a C-terminal HA tag synthesized by IDT was cloned into pLv-EF1a-IRES-puro (Addgene 85132), pAAV.TBG.PI.eGFP.WPRE.bGH (Addgene 105535) ...
-
bioRxiv - Molecular Biology 2023Quote: A fragment containing an inducible TRE-tight promoter and a LAP tag (a FLAG-tag followed by an EmGFP-tag) was inserted at the XhoI site of the plasmid pBSKDB-CAG-rtTA2sM2-IRES-tSkid-IRES-Neo (Addgene #62346), thereby generating the vector pGEH_ind_LAP-C ...
-
bioRxiv - Microbiology 2023Quote: HPV16 PsVs were produced by co-transfecting 293TT cells with wild-type p16SheLL-3XFLAG tag [14] together with pCAG-HcRed (Addgene #11152) or pCINeo-GFP [obtained from C ...
-
bioRxiv - Biophysics 2023Quote: ... UblBilA was cloned into a vector encoding a C-terminal GFP tag (UC Berkeley Macrolab vector H6-msfGFP, Addgene ID 29725) and purified as above ...
-
bioRxiv - Biochemistry 2023Quote: ... a recombinant fragment comprising part of the CM1 motif of human CDK5RAP251-100 (also referred to as γ-TuNA [32]) fused to a cleavable GFP tag (His6-SUMO-TEV-GFP-PreScission-γ-TuNA, a gift from Tarun Kapoor (Addgene plasmid # 178066 ...
-
bioRxiv - Genomics 2024Quote: ... and the top two scoring sgRNAs for each target gene based on depletion or enrichment phenotypes were cloned into dual sgRNA lentivirus expression vectors with direct capture tags (Addgene 187241)40 using NEBuilder HiFi DNA Assembly Master Mix (New England Biolabs #E2621L ...
-
bioRxiv - Cell Biology 2024Quote: ... The DNA fragment of tight TRE promoter with ATG start codon and 3XFLAG tag was amplified from pCW-Cas9 (Addgene #50661). The DNA fragment of hPGK-PuroR-rTetR was amplified from pCW-Cas9 ...
-
bioRxiv - Microbiology 2024Quote: ... The new product replaced an existing gene when inserted into pcDNA3.1 containing a triple N-FLAG-tag between KpnI and EcoRI (Addgene plasmid #67788). The GFP transfection control plasmid ...
-
bioRxiv - Neuroscience 2022Quote: ... Err2VP16 was generated by fusing the open reading frame for the herpes simplex virus-1 (HSV-1) VP16 (amplified from pActPL-VP16AD plasmid, Addgene plasmid #15305, Watertown, USA) activation domain to Err2 ...
-
bioRxiv - Neuroscience 2023Quote: We performed an initial calibrating analysis on Emx-Cre mice (see Animals) expressing Cre-dependent GFP virus (Addgene pCAG-FLEX-EGFP-WPRE; #51502-AAV9) following a dot-wise application of 1:2000 diluted virus (see Organotypic Slice Culture methods) ...
-
bioRxiv - Bioengineering 2023Quote: ... was transfected with 1 µL AAV1-hSyn1-GCaMP6f-P2A-nls-dTomato virus (Addgene viral prep #51085-AAV1, http://n2t.net/addgene:51085, RRID:Addgene 51085, a gift from Jonathan Ting) diluted 1 ...
-
bioRxiv - Biochemistry 2021Quote: ... The resulting chimera genes for the light chain and the His-tagged heavy chain of the Fabs were separately cloned into the pCAGEN vector (a gift from Connie Cepko (Addgene plasmid #11160)) 34 ...
-
bioRxiv - Biochemistry 2020Quote: ... coli RP hk339-GFP (monomeric His-tagged Kif5B kinesin motor domain) expression plasmid was a gift from Ron Vale (Addgene plasmid #24431).
-
bioRxiv - Neuroscience 2023Quote: ... 2.3 x 1013 vg/mL) or 200 nL/side AAV5-CMV-HI-eGFP-Cre-WPRE-SV4 (Addgene; ≥ 1 x 1013 vg/mL) was injected at a rate of 100 nL/min into the insula of Pdynlox/lox and Oprk1lox/lox mice ...
-
bioRxiv - Molecular Biology 2024Quote: The HTLV-1 CA (Gag amino acids 132-349) was cloned into the 6×His SUMO bacterial expression plasmid (pHYRSF53, Addgene, Watertown, MA), with mutants created by using the Gibson assembly procedure ...
-
bioRxiv - Neuroscience 2022Quote: ... Each mouse received bilateral injections (15 nl/ hemisphere at a rate of 15 nl/min) of either excitatory DREADD virus pAAV-CaMKIIa-hM3D(Gq)-mCherry (Addgene Cat# 50476-AAV5, titer: 1.7x1013) or control virus pAAV-CaMKIIa-EGFP (Addgene Cat# 50469-AAV5 ...
-
bioRxiv - Systems Biology 2020Quote: ... we indirectly titered each experimental replicate’s batch of virus by co-transducing parallel samples of HCFs with pMXs-DsRed Express (Addgene 22724; a gift from Shinya Yamanaka) and pMXs-TurboGFP (see “Cloning” above ...
-
bioRxiv - Molecular Biology 2020Quote: ... and UL87 were PCR amplified from these plasmids and cloned into BamHI/XhoI-cut pcDNA4/TO-2xStrep (C-terminal tag) using InFusion cloning (Addgene #138441-138452). Chimeras of the minimal domain (NTD ...
-
bioRxiv - Molecular Biology 2021Quote: ... ΔIDR-SHARP) were then recombined into two different modified versions of the doxycycline inducible PiggyBac destination vector PB-TAG-ERN (Addgene plasmid 80476) containing NGFR (truncated human nerve growth factor receptor ...
-
bioRxiv - Biochemistry 2021Quote: ... PLpro DNA was subcloned into the biGBac vector pLIB [29] to include an N-terminal 3xFlag-His6 tag (sequence: MDYKDHDGDYKDHDIDYKDDDDKGSHHHHHHSAVLQ) (Addgene ID 169194). Baculoviruses were generated using the EMBacY baculoviral genome [30] in Sf9 cells (Thermo Fisher Scientific) ...
-
bioRxiv - Microbiology 2022Quote: ... full length 3CLpro coding-sequences with N-terminal 6His tags were synthesized by Integrated DNA Technologies (Coralville, IA) and cloned into pET-28a(+) vector (Addgene, Cambridge, MA). Subsequently ...
-
bioRxiv - Biophysics 2022Quote: ... media was refreshed with standard growth media and cells were co-transfected with SNAP-mGluR2 (no FLAG-tag) and chimeric G protein (Gqo5, Addgene plasmid #24500) (1:2 w/w ...
-
bioRxiv - Developmental Biology 2022Quote: The pTT3-eGFP vector was constructed by replacing the C-terminal tag encoding region of a bait protein vector (52) (Addgene ID 36150) with eGFP ...
-
bioRxiv - Molecular Biology 2019Quote: ... ORF66 was subcloned into the BamHI and XhoI sites of pcDNA4/TO-2xStrep (C-terminal tag) to generate pcDNA4/TO-ORF66-2xStrep (Addgene plasmid #130953). ORF66 aa 1-200 was cloned into the NotI and XhoI sites of pcDNA4/TO-2xStrep (N-terminal tag ...
-
bioRxiv - Molecular Biology 2019Quote: ... ORF66 aa 1-200 was cloned into the NotI and XhoI sites of pcDNA4/TO-2xStrep (N-terminal tag) to generate pcDNA4/TO-2xStrep-ORF66 1-200 (Addgene plasmid #130954) and ORF66 aa 200-429 was cloned into the BamHI and XhoI sites of pcDNA4/TO-2xStrep (C-terminal tag ...
-
bioRxiv - Molecular Biology 2019Quote: ... and ORF66 aa 200-429 was cloned into the BamHI and XhoI sites of pcDNA4/TO-2xStrep (C-terminal tag) to generate pcDNA4/TO-ORF66 200-429-2xStrep (Addgene plasmid #130955). Point mutations in pcDNA4/TO-ORF66-2xStrep (Addgene plasmids #131109-131121 ...
-
bioRxiv - Genetics 2021Quote: RPA1 expression constructs were generated as derivatives of a RPA1-WT expression construct pLX304-hRPA1 bearing bearing an N-ter V5 tag (Addgene Plasmid #25890). The R41E ...
-
bioRxiv - Biochemistry 2021Quote: ... For AKAR4 purification, an 8His epitope tag was ligated into pcDNA3.1- AKAR4-NES vector (Depry et al., 2011) (Addgene cat no. 64727) at the C-terminus of the sensor immediately prior to the nuclear export site using primers EcoI_8HisNLS_XbaI and XbaI_8HisNLS_EcoRI ...
-
bioRxiv - Cell Biology 2020Quote: ... Human ASK3 cDNA was also subcloned into pcDNA3 with a C-terminal tdTomato-tag (cDNA was gifted by M. Davidson, Florida State University, via Addgene: plasmid #54653) or pcDNA4/TO with an N-terminal Venus- or EGFP-FLAG-tag ...
-
bioRxiv - Biochemistry 2021Quote: a codon optimised nagK gene from Plesiomonas shigelloides was cloned into the pOPINS3C expression plasmid (N-terminal polyhistidine and SUMO tags; Addgene #41115 (59)) ...
-
bioRxiv - Molecular Biology 2021Quote: ... TDP-43 bacterial expression vector harboring a C-terminal MBP tag (pJ4M TDP-43-TEV-MBP-6xHis) was purchased from Addgene (Plasmid # 104480). TDP-43 mutations were generated by site-directed mutagenesis using QuikChange (Agilent ...
-
bioRxiv - Genetics 2020Quote: ... as a gene block with a C-terminal HA tag and cloned into pMSCV PIG (Puro IRES GFP empty vector) - a gift from David Bartel (Addgene plasmid # 21654). Retroviruses were generated using the retroPack system (Takara ...
-
bioRxiv - Cell Biology 2023Quote: ... polyspora Hop1319-529 into UC Berkeley Macrolab vectors to generate N-terminal TEV protease-cleavable His6- or His6-maltose binding protein tags (Addgene #29666, 29706). DNA binding mutants of S ...
-
bioRxiv - Cell Biology 2023Quote: ... TDP43 was inserted by Gibson assembly at the C terminus of SNAP-tag (tdp43-EGFP was a gift from Zuoshang Xu, Addgene plasmid # 28198). Plasmids were delivered to cells using Lipofectamine 2000 according to the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2023Quote: ... with N-terminal HA tag added into primers followed by insertion into NotI/EcoRI-linearized pGCGFP-G418 (a gift from Andrew Pierce, Addgene plasmid #31264) using In-Fusion HD (Takara Bio) ...
-
bioRxiv - Biochemistry 2024Quote: The plasmid encoding amino acids 1-393 of the p53 protein with a FLAG tag at the C-terminus (Addgene plasmid #10838) was used as a template for site-directed mutagenesis to delete the N-terminal regions spanning amino acids 1-31 ...
-
bioRxiv - Molecular Biology 2023Quote: ... The 3×HA epitope tag was amplified from the pPR2-HA3 plasmid (Katris et al. 2014) and integrated into the pU6-DHFR vector (Addgene plasmid #80329). The 3×HA-DHFR cassette was amplified from the resulting vector by Q5 polymerase (NEB ...
-
bioRxiv - Neuroscience 2023Quote: Cre-dependent recombinant adeno-associated virus (rAAV) expressing GCaMP7f under the control of the Synapsin promoter (rAAV1-Syn-FLEX-jGCaMP7f-WPRE-Sv40, Addgene #104492, titer: 1 × 1013 vg/mL) was used to express GCaMP7f in interneurons.
-
bioRxiv - Cancer Biology 2023Quote: Retroviral vectors expressing the cDNA of wild-type c-Myc and GFP in the murine stem cell virus backbone were purchased from Addgene (MSCV-Myc-IRES-GFP, Plasmid #18770). Doxycycline-inducible constructs were obtained by cloning c-Myc cDNA into GC385-S backbone ...
-
bioRxiv - Neuroscience 2024Quote: ... We injected in that region 3x750nL of an adeno-associated virus (AAV) mix of AAV1.Syn.GCaMP (6m: Addgene 100841 or 7f: Addgene 104488; dilution 1:10 ∼ 1x1013 GC/mL) and AAV1.Syn.Flex.Chrimson.tdTomato (UNC Vector Core ...
-
bioRxiv - Biochemistry 2021Quote: ... Pichia pastoris expression vector pPICZc carrying human β-actin fused with thymosin β4 and 6xHis-tag was a gift from Mohan Balasubramanian (Addgene #111146, RRID:Addgene_111146). β-Actin cDNA was mutated to introduce K50C and C374A for labeling with a cross-linking reagent ...
-
bioRxiv - Bioengineering 2024Quote: ... pET28a-SUMO-SpyTag003 (N-terminal His6 tag-SUMO protein-SpyTag003) was cloned previously by Irsyad Khairil Anuar (University of Oxford) (GenBank and Addgene deposition in progress). pDEST14-SpyCatcher003-TEVs-SpyTag003DA (‘Masked SpyCatcher0003’ ...
-
bioRxiv - Bioengineering 2024Quote: ... pDEST14-SpyCatcher003-TEVs-SpyTag003DA (‘Masked SpyCatcher0003’; N-terminal His6 tag-SpyCatcher003-TEV protease cleavage site-SpyTag003 D117A, GenBank and Addgene deposition in progress) was derived from pDEST14-SpyCatcher003 (GenBank Accession no ...
-
bioRxiv - Animal Behavior and Cognition 2020Quote: ... Cas9 protein was produced by the Weizmann Institute of Science Protein Purification Unit using the pET-28b-Cas9-His (Alex Schier Lab Plasmids, Addgene, Cambridge, MA, United States) as a template ...
-
bioRxiv - Genetics 2022Quote: ... the NotI/XbaI PCR fragment of eggpl-CDS (GFP tag) was cloned into the NotI/XbaI sites of pJFRC28-10 × UAS-IVS-GFP-p10 vector (Addgene Plasmid, cat. no. 36431). The primer pairs used for PCR validation were as following:
-
bioRxiv - Neuroscience 2021Quote: ... Synaptophysin1-mCherry plasmid was generated by replacing the pHluorin-tag in Synaptophysin1-pHluorin (gift from L. Lagnado, Addgene plasmid # 24478, (Granseth et al, 2006)) with mCherry from pmCherry-N1 (Invitrogen) ...
-
bioRxiv - Genetics 2022Quote: Human PUM1 full-length cDNA was amplified by PCR and subcloned in a pRK5 plasmid containing the Myc tag sequence (Addgene, pRK5-Myc-Parkin #17612) at the N-terminal by using SalI (New England Biolabs ...
-
bioRxiv - Molecular Biology 2023Quote: ... RBM41 C-terminal fragment (259–413) and full-length 65K were cloned into MAC-tag-N vector (Addgene #108078, a gift from Markku Varjosalo) using Gateway cloning as described (Liu et al. ...
-
bioRxiv - Physiology 2019Quote: ... with a hairpin sequence: CCT AAG GTT AAG TCG CCC TCG CTC TAG CGA GGG CGA CTT AAC CTT AGG (Addgene plasmid 1864, Cambridge, MA, USA). Oligos were obtained from ITDDNA USA (Integrated DNA Technologies ...