-
No products found
because this supplier's products are not listed.
Renée M. van der Sluis, et al.,
bioRxiv - Immunology 2021
Quote:
... antibodies blocking the type I IFN receptor (mouse anti-human IFNAR2 antibody, clone MMHAR-2, PBL Assay Science Cat#21385-1) or isotype control (Ultra-LEAF Purified mouse IgG2a ...
-
No products found
because this supplier's products are not listed.
Nicholas J Swanson, et al.,
bioRxiv - Microbiology 2023
Quote:
... Lyophilized Receptor Destroying Enzyme II (RDE, Hardy Diagnostics) was dissolved into 20 mL of saline (0.9% NaCl in H2O ...
-
No products found
because this supplier's products are not listed.
Agustina Rimondi, et al.,
bioRxiv - Microbiology 2022
Quote:
... Sera were treated with receptor-destroying enzyme (Accurate Chemical and Scientific Corp. ...
-
This antibody is a chicken polyclonal antibody which specifically reacts with Progesterone Receptor.
Cat# BRD-0440MZ,
Inquiry
Ask
Andrew D. Hoffmann, et al.,
bioRxiv - Immunology 2022
Quote:
... Results were normalized to the CR3022 antibody with known affinity to the receptor binding domain of SARS-CoV2 (Creative Biolabs, MRO-1214LC)(29 ...
-
No products found
because this supplier's products are not listed.
Ami Vadgama, et al.,
bioRxiv - Immunology 2023
Quote:
... 0.3-30μM thrombin-receptor activating peptide 6 (TRAP-6; Cambridge Biosciences); 0.3-30μM U46619 (Enzo Life Sciences) ...
-
No products found
because this supplier's products are not listed.
Amanda Lillywhite, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and probed for expression of total MOR (rabbit anti-mu opioid receptor, Neuromics, RA10104, 1:500), P-ser375 MOR (rabbit anti-mu opioid receptor Ser375 ...
-
No products found
because this supplier's products are not listed.
O Bogen, et al.,
bioRxiv - Neuroscience 2024
Quote:
... psi ε receptor for activated C kinase (ψεRACK) (27) was purchased from Biomatik (Wilmington, DE, USA), and the proinflammatory cytokine prostaglandin-E2 (PGE2 ...
-
No products found
because this supplier's products are not listed.
Rory Henderson, et al.,
bioRxiv - Immunology 2023
Quote:
... The synthetic Toll-like receptor 7/8 agonist 3M-052 absorbed to ALUM (3M-052-ALUM) was used as the adjuvant for the vaccine immunogens ...
-
No products found
because this supplier's products are not listed.
Luana dos Santos Ortolan, et al.,
bioRxiv - Pathology 2019
Quote:
Soluble endothelial protein C receptor (sEPCR) was measured with an ELISA kit (Elabscience®, E-EL-M1073) according to the manufacturer’s instructions.
-
No products found
because this supplier's products are not listed.
Lorenzo Iovino, et al.,
bioRxiv - Immunology 2021
Quote:
... Silencing of the zinc receptor Gpr39 was performed by electroporation using Nucleofector electroporation kit (VPI-1001, Lonza) for exECs (Program M-003 ...
-
No products found
because this supplier's products are not listed.
S. Venkatesan, et al.,
bioRxiv - Neuroscience 2022
Quote:
... The NMDA receptor–mediated eEPSCs were analyzed as an average of 3 traces with Clampfit (Molecular Devices) and D-APV (50 μM ...
-
No products found
because this supplier's products are not listed.
Amanda G. Gibson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... either high-potassium ACSF (20 mM K+) or the neurokinin 3 receptor agonist senktide (100nM; Phoenix Pharmaceuticals, Burlingame, CA) was bath-applied ...
-
No products found
because this supplier's products are not listed.
Krishna K. Narayanan, et al.,
bioRxiv - Microbiology 2023
Quote:
... The eluted proteins were concentrated with a centrifugal device (MWCO 30 kDa for soluble EFNB2 proteins and 50 kDa for soluble Eph receptor proteins; Sartorius) before being separated on a Superdex 200 Increase 10/300 GL (Cytiva Life Sciences ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Kevin S. McLoughlin, et al.,
bioRxiv - Pharmacology and Toxicology 2023
Quote:
... 25 μL compound and 75 μL membrane with overexpressed receptor were added to 96-well white round bottom polystyrene NBS microplates (Corning #3605) and incubated on 25°C plate warmer for 90 minutes ...
-
No products found
because this supplier's products are not listed.
Szymon P. Kordon, et al.,
bioRxiv - Biochemistry 2024
Quote:
Purified receptor was diluted to ∼5 ug mL−1 and applied to freshly glow-discharged EM carbon coated copper grid (Electron Microscopy Sciences, CF400-Cu,) for 30 sec ...
-
No products found
because this supplier's products are not listed.
Vikas Arige, et al.,
bioRxiv - Physiology 2022
Quote:
... The IP3R1 antibody (#ARC154, Antibody Research Corporation) was used at 1:1000 dilution ...
-
No products found
because this supplier's products are not listed.
Mario K. Shammas, et al.,
bioRxiv - Cell Biology 2021
Quote:
... primary antibody followed by secondary antibodies (Nanogold, Nanoprobes, Yaphank, NY) for 1-2 hours ...
-
Cat# P1112,
USD $349.0/500.0µg
Ask
Fujun Hou, et al.,
bioRxiv - Microbiology 2021
Quote:
... ICP27 antibody (Virusys, 1113), 1:5000 ...
-
Make your own fluorescent antibody in one easy step.
Quick and easy - one-step labeling in 30...
Cat# K-11055-010,
1 kit, USD $360.00/ea
Ask
Katharina Hutter, et al.,
bioRxiv - Immunology 2022
Quote:
... Bound antibodies were visualized with HRP-labeled secondary antibodies and the ECL system (Advansta) on a light-sensitive film (Amersham ...
-
No products found
because this supplier's products are not listed.
Martin Privat, et al.,
bioRxiv - Neuroscience 2024
Quote:
... the primary antibody used was a rabbit anti-GFP antibody (TP401, Torrey pines biolabs) diluted 1:1000 in blocking buffer for overnight incubation ...
-
No products found
because this supplier's products are not listed.
Sherif Salah, et al.,
bioRxiv - Immunology 2022
Quote:
... and membrane antibody (by AMSBIO) were procured ...
-
No products found
because this supplier's products are not listed.
Ke Cong, et al.,
bioRxiv - Molecular Biology 2024
Quote:
... coverslips were incubated with the primary antibody anti-PAR polyclonal antibody (Trevigen 4336-BPC-100) at 37 °C for 1hr ...
-
No products found
because this supplier's products are not listed.
Laura M. Pillay, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... Membranes were incubated in primary antibody diluted in TBST (1:500 anti-RHOA antibody, Cytoskeleton ARH04) or diluted in block (1:30,000 anti-a-alpha tubulin antibody ...
-
No products found
because this supplier's products are not listed.
Boris Bonaventure, et al.,
bioRxiv - Microbiology 2021
Quote:
... or J2 anti-dsRNA antibody (SCICONS), or anti-SARS-CoV-2 Nucleoprotein (N ...
-
No products found
because this supplier's products are not listed.
Emily M. Sontag, et al.,
bioRxiv - Biochemistry 2022
Quote:
... Anti-Nsp1 antibody from EnCor Biotechnology was used to visualize nuclear pores and Anti-Nsr1 antibody from Abcam was used for staining the nucleolus.
-
No products found
because this supplier's products are not listed.
MU Wagenhäuser, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... specific antibodies were used (Emfret Analytics, GPIb/CD42b ...
-
No products found
because this supplier's products are not listed.
Juan Pablo Arroyo, et al.,
bioRxiv - Physiology 2022
Quote:
Antibody was developed with assistance from Phosphosolutions Inc ...
-
No products found
because this supplier's products are not listed.
Florian Wiede, et al.,
bioRxiv - Immunology 2019
Quote:
Serum anti-nuclear antibodies were detected with the mouse anti-nuclear antibodies Ig’s (total IgA+G+M) ELISA Kit from Alpha Diagnostic International ...
-
No products found
because this supplier's products are not listed.
Xue Chen, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Membranes were subsequently incubated in primary antibodies (Supplementary Table S2) at 4 °C overnight and probed by HRP-conjugated secondary antibodies (dilution: 1:10000; ICL) for an hour at room temperature ...
-
No products found
because this supplier's products are not listed.
Shuiyun Lan, et al.,
bioRxiv - Microbiology 2021
Quote:
... A chimeric neutralizing antibody specific against SARS-CoV-2 S protein receptor binding domain (NR-55410) was provided by ACROBiosystems through BEI resources.
-
No products found
because this supplier's products are not listed.
Michael J. Robertson, et al.,
bioRxiv - Biophysics 2022
Quote:
All receptors were expressed in Sf9 insect cells (Expression Systems) infected at a density of 3-4 million cells/ml ...
-
No products found
because this supplier's products are not listed.
Juliane Tschuck, et al.,
bioRxiv - Cell Biology 2023
Quote:
For inhibition of different receptors and proteins we used HX 531 (Biomol) as a pan-Retinoic Acid Receptor (RAR ...
-
No products found
because this supplier's products are not listed.
Bijal A. Parikh, et al.,
bioRxiv - Immunology 2019
Quote:
... Fc receptor blocking was performed with 2.4G2 (anti-FcγRII/III) hybridoma (American Type Culture Collection) culture supernatants ...
-
No products found
because this supplier's products are not listed.
Joshua D’Rozario, et al.,
bioRxiv - Immunology 2021
Quote:
Diphtheria toxin receptor (DTR) FAP+ DM2 mice received 25ng/g diphtheria toxin (List Biological Laboratories) i.p ...
-
No products found
because this supplier's products are not listed.
Kateřina Štepánková, et al.,
bioRxiv - Neuroscience 2023
Quote:
... 5HT receptor and synapsin staining was imaged with confocal microscope Olympus FV10i (Olympus Life Science, Waltham, MA, USA). The intensity of 5HT and synapsin was measured in the ventral horn by ImageJ™ and compared between 4-MU-treated and placebo group ...
-
No products found
because this supplier's products are not listed.
Yue Han, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Vesicles containing transferrin receptor were imaged using an sCMOS camera through a CFI Apo 60× 1.49 objective (Nikon) on a Ti2 microscope (Nikon) ...
-
No products found
because this supplier's products are not listed.
Rachael Kuintzle, et al.,
bioRxiv - Systems Biology 2023
Quote:
... All of the Notch receptor piggyBac constructs were derived from the vector PB-CMV-MCS-EF1-Puro (System Biosciences), with changes made to the promoter (CMV changed to PGK or CAG ...
-
PGR Antibody is a Rabbit Polyclonal against PGR.
Cat# abx339976-100UL,
100 µl USD $406.0
Ask
Michaela Frolikova, et al.,
bioRxiv - Cell Biology 2023
Quote:
... diluted 1:50 in 1% BSA in PBS and rabbit polyclonal anti-Folate receptor 4 (Juno) (abx102438, Abbexa, UK) diluted 1:50 in 1% BSA in PBS followed by 1 hr ...
-
No products found
because this supplier's products are not listed.
NV DiBenedetto, et al.,
bioRxiv - Microbiology 2023
Quote:
... diluted at 4ng/ml in PBS was used for the capture antibodies and the T4G1 monoclonal antibodies previously coupled to biotin were used as detection antibodies (BBI solution, 1:10000 dilution) with streptavidin HRP (Thermo Fisher Scientific) ...
-
No products found
because this supplier's products are not listed.
Kishor Dnyaneshwar Ingole, et al.,
bioRxiv - Plant Biology 2020
Quote:
... or anti-Actin C3 antibodies (Abiocode)] in 1X TBST at 4°C for overnight ...
-
No products found
because this supplier's products are not listed.
Chao Wang, et al.,
bioRxiv - Cell Biology 2019
Quote:
... anti-mouse-HRP antibody (ImmunoVision Technologies) was added and the cells were incubated with the secondary antibody for 2 hrs ...
-
No products found
because this supplier's products are not listed.
Oiti Kar, et al.,
bioRxiv - Microbiology 2023
Quote:
... Monoclonal antibodies against Stx2A (Hycult Biotech) and homemade OmpA antiserum36 were used to detect Stx2A and OmpA ...
-
No products found
because this supplier's products are not listed.
Hong Liu, et al.,
bioRxiv - Microbiology 2020
Quote:
... fumigatus primary antibody (Meridian Life Science, Inc.) followed by an AlexaFluor 568-labeled secondary antibody (Life Technologies) ...
-
No products found
because this supplier's products are not listed.
Dan Zhu, et al.,
bioRxiv - Microbiology 2020
Quote:
... or anti-β-actin antibody (Solarbio, China).
-
No products found
because this supplier's products are not listed.
Michael G. Spelios, et al.,
bioRxiv - Immunology 2021
Quote:
... A SARS-CoV-2 neutralization antibody (EpiGentek), which targets the spike RBD ...
-
No products found
because this supplier's products are not listed.
Shijie Cao, et al.,
bioRxiv - Bioengineering 2023
Quote:
... and plasma was analyzed for anti-OVA total IgG antibodies using a mouse anti-OVA IgG antibody assay kit (Chondrex). On day 13 ...
-
No products found
because this supplier's products are not listed.
Sushant Bhat, et al.,
bioRxiv - Microbiology 2021
Quote:
... (ID Vet) and Influenza A Antibody ELISA (IDEXX) were performed according to manufacturers’ instructions.
-
No products found
because this supplier's products are not listed.
Anais Fradet, Jamie Fitzgerald,
bioRxiv - Cell Biology 2022
Quote:
... the mouse antibody from Echelon Biosciences (Z-P345B) was used using the conditions recommended by the manufacturer ...
-
No products found
because this supplier's products are not listed.
Ria Göttert, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Primary antibodies were applied in the following concentrations: mouse anti-CD45 (EXBIO) 1:100 ...