Labshake search
Citations for Evrogen :
1 - 22 of 22 citations for Progesterone Receptor PGR Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Cell Biology 2022Quote: ... and in primary antibody (α-tRFP, [mKate antibody, Evrogen, AB233] ...
-
bioRxiv - Microbiology 2020Quote: ... This was incubated with the appropriate antibodies (anti-GFP polyclonal antibody and anti-tRFP antibody, Evrogen, reference # AB233) and revealed with Roche LumiLight ECL kit after incubation with secondary antibody.
-
bioRxiv - Plant Biology 2020Quote: ... an anti-TagRFP antibody (Evrogen) was added to the beads ...
-
bioRxiv - Molecular Biology 2023Quote: ... Anti-tRFP primary antibodies (Evrogen, Russia) were used with Goat anti-rabbit IgG-peroxidase conjugate (Sigma Aldrich ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-TagGFP2 antibody (Evrogen #AB121; 1:3000). HRP-conjugated secondary antibodies were purchased from The Jackson Laboratory.
-
bioRxiv - Biophysics 2024Quote: ... or an anti-KillerRed antibody (#AB961, Evrogen, Moscow, Russia) in CanGet signal immunoreaction enhancer solution 1 (TOYOBO ...
-
bioRxiv - Pathology 2019Quote: ... The protein samples were detected with a polyclonal anti-tRFP antibody (Evrogen) for TagBFP ...
-
bioRxiv - Cancer Biology 2024Quote: ... The following primary antibodies were used: mKate2 (Evrogen #AB233, 1:1,000, IF), SMAD4 (Millipore #04-1033 ...
-
bioRxiv - Microbiology 2024Quote: ... and rabbit monoclonal antibodies to GFP (598; MBL) and TagRFP (AB233; Evrogen). Rabbit polyclonal antibodies to US11 were described previously 41 ...
-
bioRxiv - Molecular Biology 2020Quote: ... we used rabbit polyclonal Anti-tRFP and Anti-TurboGFP(d) antibodies (Evrogen, Russia) diluted at 1:7000 ...
-
bioRxiv - Microbiology 2020Quote: ... Chlamydiae were stained with polyclonal a rabbit anti-tRFP antibody (Evrogen, Cat. # 233), which recognized the RFP mKate protein ...
-
bioRxiv - Cancer Biology 2019Quote: ... Primary antibodies were used: anti-GFP in a titer of 1:8000 (AB011, Evrogen, Russia), anti-NCL in a titer of 1:7000 (#a300-711A ...
-
bioRxiv - Neuroscience 2020Quote: ... (ii) the same solution containing the primary antibody overnight at 4°C (anti-tRFP, 1:1000, Evrogen; anti-GABA ...
-
bioRxiv - Cell Biology 2022Quote: ... Mouse anti-Aub antibody (1:20) (Patil and Kai 2010) or mouse anti-mKate2 (Evrogen, 1:200) was added to the cleared lysate and incubated at 4°C for 2 h with rotation ...
-
bioRxiv - Cell Biology 2020Quote: ... Input and bound fractions were subjected to SDS-PAGE followed by immunoblotting analysis with anti-TagRFP antibody (Evrogen, Moskau, Russia) and anti-GFP antibody (3H9 ...
-
bioRxiv - Molecular Biology 2020Quote: ... pre-washed cells were lysed in x1 Laemmli buffer and analyzed with one-dimensional PAGE followed by western blotting using Anti-TurboGFP(d) antibodies (Evrogen, Russia).
-
bioRxiv - Neuroscience 2019Quote: ... They were then incubated with primary antibodies, rat monoclonal anti-GFP (Nacalai Tesque, GF090R) at 1:2000 and rabbit polyclonal anti-tRFP (Evrogen, AB233) at 1:2000 ...
-
bioRxiv - Cell Biology 2019Quote: ... Membranes were incubated overnight with rabbit anti-tagRFP (which recognise also tagBFP) or rabbit anti-tag(CGY)FP primary antibodies (both from Evrogen, Milan, Italy) at 1:5000 in PBST with 0.5% non-fat dry milk ...
-
Molecular coevolution of nuclear and nucleolar localization signals inside basic domain of HIV-1 TatbioRxiv - Evolutionary Biology 2021Quote: ... The membranes were blocked in 1% bovine serum albumin and incubated with either a monoclonal antibody against GFP (1:3000; Evrogen, Moscow, Russia) or a monoclonal antibody against B23 (1:10,000 ...
-
bioRxiv - Cell Biology 2021Quote: ... Blots were incubated overnight at 4°C with primary antibodies targeting Tag(CGY)FP (1:2000 dilution in 1% milk, Evrogen, Cat#: AB121), HaloTag (1:1000 dilution in 0.5% milk ...
-
bioRxiv - Cell Biology 2022Quote: ... and incubated with the antibody (mouse anti-GFP [Thermos Fisher Scientific, 3E6, 1:500] or mouse anti-mKate2 [Evrogen, AB233, 1:500]) overnight at 4°C ...