-
No products found
because this supplier's products are not listed.
James Varani, et al.,
bioRxiv - Molecular Biology 2022
Quote:
... interleukin 1-β (IL-1ß; 25 ng/mL, Shenandoah Biotech), and interferon-γ (IFN-γ ...
-
No products found
Takumi Saito, et al.,
bioRxiv - Bioengineering 2020
Quote:
... and anti-beta-actin (G043, ABM) were used for detecting endogenous TAGLN2 proteins ...
-
SMO agonist
Sold for research purposes only.
Cat# 1690.0, SKU# 1690-25 mg,
25mg, US $418.00 / EA, EURO, €380 / EA
Ask
Martha Paluschinski, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... cells were administrated with 10 µM of the TGFβ receptor-I inhibitor SB431542 (Axon Medchem LLC, Groningen, Netherlands) and incubated for 3 hours before addition of TGFβ1.
-
No products found
because this supplier's products are not listed.
Holger Dill, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Staining of acetylcholine receptors was performed with 10 µg/ml CF®488A conjugated α-Bungarotoxin (Biotrend, Cologne, Germany) in PBST complemented with 10% FCS and 1% DMSO.
-
IL10RB Antibody is a Rabbit Polyclonal against IL10RB.
Cat# abx338874-50UG,
50 µg USD $290.0
Ask
Robert Schierwagen, et al.,
bioRxiv - Molecular Biology 2021
Quote:
We determined plasma levels of beta-arrestin-2 using an ELISA kit (Human Beta-arrestin-2 ELISA Kit; # abx251362; Abbexa) according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Agustina Rimondi, et al.,
bioRxiv - Microbiology 2022
Quote:
... Sera were treated with receptor-destroying enzyme (Accurate Chemical and Scientific Corp. ...
-
No products found
because this supplier's products are not listed.
Thomas S. Lisse,
bioRxiv - Cancer Biology 2020
Quote:
... The vitamin D receptor antagonist ZK159222 (VAZ, Toronto Research Chemicals) was reconstituted in ethanol and kept at −80°C (Ochiai E et al ...
-
No products found
because this supplier's products are not listed.
Brogan Ashley, et al.,
bioRxiv - Physiology 2021
Quote:
... or 2 μM Receptor Associated Protein (RAP; Innovative Research, USA), which block pinocytosis ...
-
No products found
because this supplier's products are not listed.
Justin E. Silpe, et al.,
bioRxiv - Microbiology 2021
Quote:
... and 500 μM isopropyl beta-D-1-thiogalactopyranoside (IPTG, Teknova), unless otherwise specified.
-
No products found
because this supplier's products are not listed.
Eleanor M Denham, et al.,
bioRxiv - Immunology 2019
Quote:
Cells were analysed for receptor surface expression by flow cytometry using anti-Strep-tag II antibody Oyster 645 (IBA Lifesciences # 2-1555-050), or anti-Strep-tag II antibody (IBA Lifesciences # 2-1507-001 ...
-
No products found
because this supplier's products are not listed.
Tyler N. Starr, et al.,
bioRxiv - Microbiology 2022
Quote:
... BioSample SAMN25941479 (together with prior Beta PacBio reads under BioSample SAMN22208699 (14)) ...
-
No products found
because this supplier's products are not listed.
Krishnapriya Hari, et al.,
bioRxiv - Neuroscience 2021
Quote:
... including anti-α5 GABAA receptor subunit (AAP34984, Aviva Systems Biology, San Diego, USA), anti-α1 GABAA receptor subunit (224-2P ...
-
No products found
because this supplier's products are not listed.
Ahlem Assali, et al.,
bioRxiv - Neuroscience 2023
Quote:
... XGal staining was performed using the beta-galactosidase staining kit (Mirus #MIR 2600), following the provided protocol ...
-
No products found
because this supplier's products are not listed.
Yukun Wang, Huaizhou Jin, Yongli Zhang,
bioRxiv - Biophysics 2021
Quote:
... 1~2 μL dilution of such streptavidin-DNA mixture containing 1~10 ng DNA was mixed with 10 μL anti-digoxigenin antibody coated polystyrene beads 2.1 μm in diameter (Spherotech) and incubated at room temperature for 15 min ...
-
No products found
because this supplier's products are not listed.
Giulia Tebaldi, et al.,
bioRxiv - Microbiology 2020
Quote:
... and the beta-galactosidase activity was read at 595 nm with an ELx808 microtiter plate reader (BioTek Instruments ...
-
No products found
because this supplier's products are not listed.
Liwei Yang, et al.,
bioRxiv - Bioengineering 2021
Quote:
... 50 μL of 1 mg/mL antibodies were reacted with 1 μL of 10 mM UV-cleavable azido-NHS ester (30 equivalents to antibodies; Click Chemistry Tools) for 2 h ...
-
LC Laboratories' Product Number N-8207 - Nilotinib, Free Base (Tasigna, AMN-107), >99% - for...
Cat# N-8207, SKU# N-8207_250mg,
250 mg, $47.00
Ask
Sehar Ali, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... VEGFR2 tyrosine kinase inhibitor (Vatalanib) and colony stimulating factor 1 receptor (CSF1R) inhibitor (GW2580) were purchased from LC Laboratories, Woburn ...
-
No products found
because this supplier's products are not listed.
Jothi K. Yuvaraj, et al.,
bioRxiv - Neuroscience 2020
Quote:
... after which cells were investigated for ligand-induced receptor activation using a FLUOstar Omega plate reader (BMG Labtech, Ortenberg, Germany). Cells were tested in triplicates (technical replicates ...
-
No products found
because this supplier's products are not listed.
Kariem Ezzat, et al.,
bioRxiv - Microbiology 2019
Quote:
... The sections were washed using the same buffer and bound antibodies were detected using secondary antibodies coated with 10 nm gold (BBI solution, Analytic standard, Sweden) at a final dilution of 1:100 ...
-
No products found
because this supplier's products are not listed.
Adrià Sogues, et al.,
bioRxiv - Microbiology 2019
Quote:
Detergent-solubilized protein extracts were incubated with 50 μl of magnetic beads crosslinked with 10 μg of purified anti-Scarlet antibody (produced by Covalab). Beads were collected with a magnetic stand and washed 3 times with lysis buffer and bound material was eluted in 0.1 M glycine pH 2.5 for 10 min at 4 °C ...
-
No products found
because this supplier's products are not listed.
Katri Vaparanta, et al.,
bioRxiv - Cell Biology 2022
Quote:
... 10% horse serum (PromoCell), 5% fetal calf serum (Biowest) ...
-
No products found
because this supplier's products are not listed.
Chongping Li, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... and goat anti-mouse IgG secondary antibody (L3032, Signalway Antibody).
-
No products found
because this supplier's products are not listed.
Min Hu, et al.,
bioRxiv - Biochemistry 2020
Quote:
... 10 μL CCK-8 (Solarbio) was added to a 96-well plate ...
-
No products found
because this supplier's products are not listed.
Murat Sunbul, et al.,
bioRxiv - Cell Biology 2020
Quote:
... 250×10 mm (Phenomenex Ltd.) and compounds were eluted with a mixture of buffer A consisting of 100 mM Et3N/AcOH (pH 7.0 ...
-
No products found
because this supplier's products are not listed.
Moises Freitas-Andrade, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... 10% FBS (Wisent BioProducts, 115727) and 1% penicillin/streptomycin (ThermoFisher ...
-
No products found
because this supplier's products are not listed.
Said Izreig, et al.,
bioRxiv - Cancer Biology 2019
Quote:
... or 10 µL IM156 medium containing 10% dialyzed FBS and [13C]-glutamine (Cambridge Isotope Laboratories). Cells were washed twice with normal saline ...
-
No products found
because this supplier's products are not listed.
Roy G. Muriu, Jessica M. Sage, Abdulbaki Agbas,
bioRxiv - Neuroscience 2019
Quote:
... MBL antibodies (MBL International, 15A Constitution way ...
-
No products found
because this supplier's products are not listed.
Victor S. Ekun, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 2.5μl of 10 x Buffer (Bioline), 1.25μl of 50mM MgCl2 (Bioline) ...
-
No products found
because this supplier's products are not listed.
Xiu-Qi Tian, Yao Wu, Zhen Cai, Wei Qian,
bioRxiv - Microbiology 2022
Quote:
... 10 mg liposomes (Avanti Polar Lipids) were dissolved in 1 mL buffer (50 mM Tris-HCl ...
-
No products found
because this supplier's products are not listed.
Rutger A.F. Gjaltema, et al.,
bioRxiv - Genomics 2021
Quote:
... 10 μl Concanavalin A (Bangs Laboratories) beads were equilibrated with 100 μl Binding buffer (20 mM HEPES-KOH ...
-
No products found
because this supplier's products are not listed.
MR Blake, et al.,
bioRxiv - Neuroscience 2022
Quote:
... and either laminin (10 μg/mL, Trevigen), laminin and CSPGs (2μg/mL ...
-
No products found
because this supplier's products are not listed.
Assaf Alon, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
Purified σ2 receptor was reconstituted into lipidic cubic phase (LCP) by mixing with a 10:1 (w:w) mix of monoolein (Hampton Research) with cholesterol (Sigma Aldrich ...
-
No products found
because this supplier's products are not listed.
Mohita Tagore, et al.,
bioRxiv - Cancer Biology 2021
Quote:
... or DMH1 (BMP receptor, Sigma #D8946, 0.5 µM) or EC330 (LIF receptor ...
-
No products found
because this supplier's products are not listed.
Nicholas J Swanson, et al.,
bioRxiv - Microbiology 2023
Quote:
... Lyophilized Receptor Destroying Enzyme II (RDE, Hardy Diagnostics) was dissolved into 20 mL of saline (0.9% NaCl in H2O ...
-
This product is a made-to-order Human IL10RB membrane protein expressed in HEK293. The protein...
Cat# MPC4090K,
1.0 case, Inquiry
Ask
Andrew D. Hoffmann, et al.,
bioRxiv - Immunology 2022
Quote:
... Results were normalized to the CR3022 antibody with known affinity to the receptor binding domain of SARS-CoV2 (Creative Biolabs, MRO-1214LC)(29 ...
-
No products found
because this supplier's products are not listed.
Joshua D’Rozario, et al.,
bioRxiv - Immunology 2021
Quote:
Diphtheria toxin receptor (DTR) FAP+ DM2 mice received 25ng/g diphtheria toxin (List Biological Laboratories) i.p ...
-
No products found
because this supplier's products are not listed.
Melanie D Schaffler, et al.,
bioRxiv - Neuroscience 2022
Quote:
... and 10 mg of mouse anti-NeuN monoclonal antibody (Encor Biotechnology, #MCA-1B7) followed by fluorescently conjugated secondaries in 1:2 primary ...
-
No products found
because this supplier's products are not listed.
Amanda G. Gibson, et al.,
bioRxiv - Neuroscience 2021
Quote:
... either high-potassium ACSF (20 mM K+) or the neurokinin 3 receptor agonist senktide (100nM; Phoenix Pharmaceuticals, Burlingame, CA) was bath-applied ...
-
No products found
because this supplier's products are not listed.
Melissa Govender, et al.,
bioRxiv - Immunology 2022
Quote:
... including anti-spike neutralizing IgG antibodies directed against the receptor binding domain (RBD) of S1 subunit was performed using a commercial chemiluminescent microparticle-based immune assay (Abbott SARS-CoV-2 IgG II Quant/6S60 ARCHITECT SARS-CoV-2 IgG kit ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
Make your own fluorescent antibody in one easy step.
Quick and easy - one-step labeling in 30...
Cat# K-11055-010,
1 kit, USD $360.00/ea
Ask
Maik Wolfram-Schauerte, et al.,
bioRxiv - Microbiology 2023
Quote:
... Membranes were washed and incubated with 10 ml of a 1:10,000 dilution of the horseradish-peroxidase-(HRP)-goat-anti-rabbit-IgG secondary antibody (Advansta) in washing buffer at room temperature for 1 h ...
-
No products found
because this supplier's products are not listed.
Jérémy Argenty, et al.,
bioRxiv - Immunology 2022
Quote:
... CD4+ T cells were cultured with 10 μg/ml of anti-CD3 and 2 μg/ml of anti-CD28 antibodies on a chambered glass coverslip (IBIDI) for 24 hours ...
-
No products found
because this supplier's products are not listed.
Ljiljana Mihajlovic, et al.,
bioRxiv - Evolutionary Biology 2023
Quote:
... We used a precast gel (Biorad, 10% Mini-Protean, 10 wells) to load 15 µl of sample per well and a Biorad PAGE system for 5 min at 50 V ...
-
No products found
because this supplier's products are not listed.
Jérôme Cattin-Ortolá, et al.,
bioRxiv - Cell Biology 2019
Quote:
... 10% horse serum (RMBIO), and 700 µg/ml G418) ...
-
No products found
because this supplier's products are not listed.
Helen Fong, et al.,
bioRxiv - Cell Biology 2024
Quote:
... + 10% huABS (Valley Biomedical). Cells were either left unactivated or activated with Immunocult Human CD3/CD28/CD2 T cell activator per manufacturer’s instructions (StemCell Technologies ...
-
No products found
because this supplier's products are not listed.
Mario K. Shammas, et al.,
bioRxiv - Cell Biology 2021
Quote:
... primary antibody followed by secondary antibodies (Nanogold, Nanoprobes, Yaphank, NY) for 1-2 hours ...
-
No products found
because this supplier's products are not listed.
Alexander J. Stevenson, et al.,
bioRxiv - Cell Biology 2020
Quote:
... Y27632 (10 μM, Abmole, M1817) or a combination of ML-7 and Y27632 were performed for 10-20 min in PSS ...
-
35mm glass bottom dish, dish size 35mm, well size 10mm, #1 cover glass(0.13-0.16mm). Designed...
Cat# D35-10-1-N,
100/case, $119.00
Ask
Wanqiu Ding, et al.,
bioRxiv - Evolutionary Biology 2023
Quote:
... HeLa-S3 cells were grown in 10 mm glass-bottom imaging dishes (Cellvis, #D35-10-1-N) with 2 mL of modified medium (high-glucose DMEM ...
-
No products found
because this supplier's products are not listed.
Paul Bowyer, et al.,
bioRxiv - Genomics 2022
Quote:
... genomic DNA was adjusted to 10 ng/μL in 150 μL volume and sheared to approximately 10 kb fragments using g-TUBES (Covaris) following the manufacturers’ instructions ...
-
No products found
because this supplier's products are not listed.
Danny F. Xie, et al.,
bioRxiv - Bioengineering 2022
Quote:
1x angled scissors (Fine Science Tools: 15010-10)