-
No products found
because this supplier's products are not listed.
Veronica Gonzalez, et al.,
bioRxiv - Genomics 2021
Quote:
... that contained alpha-thio-ddNTPs (Trilink Bio Technologies) at equal ratios at a concentration of 1200 μM in the final amplification reaction ...
-
No products found
because this supplier's products are not listed.
Madeleine F. Jennewein, et al.,
bioRxiv - Immunology 2021
Quote:
To investigate Fc receptor binding recombinant Fc receptors with an AviTag were biotinylated using a Bir500 kit (Avidity, Aurora, CO, USA) according to manufacturer’s instructions and purified using a Zeba Spin Desalting Column ...
-
No products found
because this supplier's products are not listed.
Thomas S. Lisse,
bioRxiv - Cancer Biology 2020
Quote:
... The vitamin D receptor antagonist ZK159222 (VAZ, Toronto Research Chemicals) was reconstituted in ethanol and kept at −80°C (Ochiai E et al ...
-
No products found
because this supplier's products are not listed.
Julian Schöllkopf, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
N-terminally His-tagged Pasteurella multocida toxin (PMT) was coated at 10 µg/mL (500 ng/well ...
-
No products found
because this supplier's products are not listed.
Alexander B. Coley, et al.,
bioRxiv - Cancer Biology 2021
Quote:
Human embryonic kidney (HEK293) cell line was obtained from GenLantis (San Diego, CA) and cultured in MEM (Mediatech ...
-
No products found
because this supplier's products are not listed.
Anil Verma, et al.,
bioRxiv - Immunology 2023
Quote:
... were labeled with biotinylated anti-His tag monoclonal antibody (ThermoScientific) and used to capture His-tagged clade C gp120 Du151 protein (Immune Technologies). The gp120-expressing beads were then incubated with triplicate 5-fold dilutions of heat-inactivated serum samples in V-bottom plates for 1h at 37°C ...
-
No products found
because this supplier's products are not listed.
Satoshi Imanishi, et al.,
bioRxiv - Pharmacology and Toxicology 2022
Quote:
... and the corresponding His tag (R06-32BH) were obtained from SignalChem Lifesciences (Richmond ...
-
No products found
because this supplier's products are not listed.
Huang Zhu, Dan S. Kaufman,
bioRxiv - Immunology 2019
Quote:
... 15 % heat-inactivated human AB serum (Valley Biomedical, Catalog # HP1022 HI),1 % P/S ...
-
No products found
because this supplier's products are not listed.
Joshua D’Rozario, et al.,
bioRxiv - Immunology 2021
Quote:
Diphtheria toxin receptor (DTR) FAP+ DM2 mice received 25ng/g diphtheria toxin (List Biological Laboratories) i.p ...
-
No products found
because this supplier's products are not listed.
Amanda Lillywhite, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and probed for expression of total MOR (rabbit anti-mu opioid receptor, Neuromics, RA10104, 1:500), P-ser375 MOR (rabbit anti-mu opioid receptor Ser375 ...
-
No products found
because this supplier's products are not listed.
Ben S. Ou, et al.,
bioRxiv - Immunology 2023
Quote:
... Heat Inactivated fetal bovine serum (HI-FBS) was purchased from Atlanta Biologicals. IFN-α cytokine enzyme-linked immunosorbent assay (ELISA ...
-
No products found
because this supplier's products are not listed.
Agnès Roure, Rafath Chowdhury, Sébastien Darras,
bioRxiv - Developmental Biology 2022
Quote:
... or 2.5 μM of the BMP receptor inhibitor DMH1 (S7146, Euromedex, 10 mM stock solution in DMSO) at the stages indicated in the text and figures ...
-
No products found
because this supplier's products are not listed.
Jordan A. Stinson, et al.,
bioRxiv - Cancer Biology 2024
Quote:
... stable HEK293-F cell lines for each cytokine were prepared through cloning into the expression cassette of PiggyBac (System Biosciences) transposon vector ...
-
No products found
because this supplier's products are not listed.
Saurabh Srivastava, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The optimal receptor-binding domain (OBD) (100, 100) of Tetanus Toxin (Heavy Chain/B Subunit) was synthesized by GENEWIZ (incorporating flanking 5’ Hindlll and 3’ Nco1 restriction sites ...
-
No products found
because this supplier's products are not listed.
N.D. Maxwell, et al.,
bioRxiv - Neuroscience 2023
Quote:
... CA) using probes against the leptin receptor mRNA (Cat# 415951) and Opal 650 dye kit (Akoya Biosciences, Marlborough, MA) to label LepR mRNA ...
-
No products found
because this supplier's products are not listed.
MU Wagenhäuser, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... For the platelet depletion experiments mice were injected with platelet depletion antibody (Emfret Analytics, polyclonal anti-GPIb alpha #R300) and a corresponding IgG antibody (Emfret Analytics ...
-
No products found
because this supplier's products are not listed.
Liam Hudson, et al.,
bioRxiv - Biochemistry 2023
Quote:
... C-His tagged IDH1 R132H (Met1-Leu414) was purchased from G-Biosciences (BAN1708, 50 µg). N-His and GST tagged USP7 (Lys208-Glu560 ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Parul Verma, et al.,
bioRxiv - Neuroscience 2020
Quote:
... and 100 µM L-alpha-phosphatidyl-D-myo-inositol 4,5-diphosphate, dioctanoyl (PIP2, KDR enhancer) were diluted in NbActiv4 recording media (BrainBits, Springfield, IL, USA). Complete saline solution (CSS ...
-
No products found
because this supplier's products are not listed.
Oskar Staufer, et al.,
bioRxiv - Immunology 2022
Quote:
... beads were incubated with varying amount of the recombinant his-tagged proteins and corresponding MFIs were compared to reference beads of know AlexFluor molecule densities (Bangs Laboratories, IN).
-
No products found
because this supplier's products are not listed.
Yi-Nan Zhang, et al.,
bioRxiv - Immunology 2021
Quote:
... Recombinant mouse Flt3 ligand (Flt3L) and mouse SCF were purchased from Shenandoah Biotech (Warwick, PA). Cells were stained with appropriate concentrations of mAbs ...
-
No products found
Richard J. Roller, et al.,
bioRxiv - Microbiology 2021
Quote:
... or mouse anti-VP5 (Biodesign. International) 1:500 ...
-
No products found
because this supplier's products are not listed.
Xiaodan Zhang, et al.,
bioRxiv - Genomics 2021
Quote:
... anti-mouse Lyve1 antibody (1:100, AngioBio cat.no ...
-
No products found
because this supplier's products are not listed.
Rita R. Fagan, et al.,
bioRxiv - Neuroscience 2020
Quote:
... mouse anti-SERT (ST51-2; Mab Technologies), rabbit anti-HA (C29F4 ...
-
No products found
because this supplier's products are not listed.
Thomas Keating, et al.,
bioRxiv - Immunology 2021
Quote:
... 1:500 mouse anti-human C1q (Quidel) or 1:100 mouse anti-human Ficolin-3 (Hycult ...
-
No products found
because this supplier's products are not listed.
Kristen N. Haggerty, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Nanogold-Fab’ goat anti-mouse (Nanoprobes Cat# 2002, RRID:AB_2637031), and Nanogold-Fab’ goat anti-rabbit (Nanoprobes Cat# 2004 ...
-
No products found
because this supplier's products are not listed.
Seraina A. Domenig, et al.,
bioRxiv - Cell Biology 2023
Quote:
... at 37°C using DirectPCR Lysis Reagent (mouse tail) (VIG102-T, Viagen Biotech). PCR for Pax7-nGFP was performed using primer Pax7nGFP.F/ Pax7nGFP.R and GoTaq G2 Hot Start Green Master Mix (M7423 ...
-
No products found
because this supplier's products are not listed.
Qian Shi, et al.,
bioRxiv - Physiology 2022
Quote:
... anti-β2-adrenergic receptor (β2AR) (A-B2AR, Badrilla), anti-β1-adrenergic receptor (β1AR ...
-
No products found
because this supplier's products are not listed.
Vibeke D. Valderhaug, et al.,
bioRxiv - Neuroscience 2020
Quote:
... 1mg alpha-synuclein monomers (S-1001-1, rPeptide) was resuspended in 1mL MilliQ water ...
-
No products found
because this supplier's products are not listed.
Julio Aleman, et al.,
bioRxiv - Bioengineering 2021
Quote:
... The secreted levels of alpha-GST by the organoids were quantified using a GST alpha assay kit (GS41, Oxford Biomedical Research; Rochester Hills, MI). Absorbance was read on a Spectramax M5 plate reader (Molecular Devices ...
-
No products found
because this supplier's products are not listed.
Harsharan Singh Bhatia, et al.,
bioRxiv - Bioengineering 2021
Quote:
... and 0.4% Vol vitamin E (DL-alpha-tocopherol, Alfa Aesar, A17039), for at least 6 hours at room temperature until achieving transparency.
-
No products found
because this supplier's products are not listed.
Thomas D. Avery, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
NRF2/ARE luciferase reporter HEK293 cells (SL-0042-NP, Signosis, Santa Clara, USA) were maintained in Dulbecco’s Modified Eagle’s Medium (DMEM ...
-
No products found
because this supplier's products are not listed.
Juliane Tschuck, et al.,
bioRxiv - Cell Biology 2023
Quote:
For inhibition of different receptors and proteins we used HX 531 (Biomol) as a pan-Retinoic Acid Receptor (RAR ...
-
No products found
because this supplier's products are not listed.
Awadhesh Kumar Verma, et al.,
bioRxiv - Biophysics 2022
Quote:
... For this we have used Raman-AFM Microscope alpha 300 RA (Oxford Instruments). The time-resolved fluorescence measurement of PVA Capped ZnO and PVP capped ZnO in the absence and presence of antibiotics was recorded at 360 nm emission wavelength using Time Resolved Fluorescence Spectrometer (TRFS ...
-
No products found
because this supplier's products are not listed.
Kari H. Ecklund, et al.,
bioRxiv - Cell Biology 2021
Quote:
Anti-His-coated 0.44 μm microbeads (PSS4; Spherotech; prepared as described previously72) were incubated with purified 6His-GFP-3HA-GST-dynein331-HALO in dynein trapping buffer (30 mM HEPES pH 7.2 ...
-
No products found
because this supplier's products are not listed.
Advika Kamatar, et al.,
bioRxiv - Biophysics 2023
Quote:
... His-Clathrin was labeled with Atto594 NHS-ester (ATTO-TEC, Sigma-Aldrich) according to a previously published protocol (41 ...
-
No products found
because this supplier's products are not listed.
Cathal Meehan, et al.,
bioRxiv - Biochemistry 2023
Quote:
... Recombinant IL-6 with an N-terminal his tag (Fitzgerald, Biosynth Ltd.) was immobilized on His-Pur™ Ni-NTA Resin (ThermoScientific ...
-
No products found
because this supplier's products are not listed.
Somboon Wankanit, et al.,
bioRxiv - Molecular Biology 2024
Quote:
A total of 350,000 HEK293-T cells were seeded in each well of 6-well plates (#EP0030720113, Eppendorf). Transfection was performed the day after at 40-50% cell confluence ...
-
No products found
because this supplier's products are not listed.
Jothi K. Yuvaraj, et al.,
bioRxiv - Neuroscience 2020
Quote:
... after which cells were investigated for ligand-induced receptor activation using a FLUOstar Omega plate reader (BMG Labtech, Ortenberg, Germany). Cells were tested in triplicates (technical replicates ...
-
No products found
because this supplier's products are not listed.
Parker C. Wilson, et al.,
bioRxiv - Genomics 2022
Quote:
... Antibodies were added to each sample (0.5μg of rabbit glucocorticoid receptor antibody [abcam, ab225886, 1:20] or rabbit IgG negative control antibody [Epicypher, 13-0041k, 1:50]). The remaining steps were performed according to manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Vincent Soubannier, et al.,
bioRxiv - Neuroscience 2019
Quote:
... human iPSC-derived astrocytes were incubated with tumour necrosis factor alpha (TNFa) (30 ng/ml; Cell Sciences; Newburyport, MA; Cat. No. CRT100B), interleukin alpha (IL-1a ...
-
No products found
because this supplier's products are not listed.
Maria Jose Lista, et al.,
bioRxiv - Microbiology 2021
Quote:
... a set of overlapping cDNA fragments representing the entire genomes of SARS-CoV-2 Wuhan isolate (GenBank: MN908947.3) and the B.1.1.7 alpha variant were chemically synthesized and cloned into pUC57-Kan (Bio Basic Canada Inc and Genewiz, respectively). The cDNA fragment representing the 5’ terminus of the viral genome contained the bacteriophage T7 RNA polymerase promoter preceded by a short sequence stretch homologous to the XhoI-cut end of the TAR in yeast vector pEB2(Gaida et al. ...
-
No products found
because this supplier's products are not listed.
Yun Jin Chae, et al.,
bioRxiv - Bioengineering 2023
Quote:
... Tissue samples were incubated for 3 h at RT with the primary antibody (anti-CD8 alpha) before visualization with the Polink-2 HRP Plus Broad DAB Detection System for Immunohistochemistry kit (GBI Labs, Bothell, WA) according to the manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
Mitchell R. Lewis, Tara L. Deans,
bioRxiv - Synthetic Biology 2023
Quote:
Mouse embryonic stem cells (harvested from a TARGATT mouse, Applied StemCell) (see Note 1).
-
No products found
because this supplier's products are not listed.
Aditi Verma, et al.,
bioRxiv - Neuroscience 2020
Quote:
... Mouse brain was placed on mouse brain matrix (Ted Pella, Inc Cat# 15050) and 1mm thick slices of the brain were obtained for the dissection of SNpc ...
-
No products found
because this supplier's products are not listed.
Vaibhav Sidarala, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Anti-mouse TFAM (1:1000; PhosphoSolutions 2001-TFAM), Tom20 (1:1000 ...
-
No products found
because this supplier's products are not listed.
Robert N. Plasschaert, et al.,
bioRxiv - Neuroscience 2021
Quote:
RAW264.7 mouse macrophage cells (ATCC; confirmed by STR profiling, IDEXX) were transduced with increasing multiplicity of infections with LVV.GRN or LVV.GBA vector ...
-
No products found
because this supplier's products are not listed.
Yue Gao, et al.,
bioRxiv - Systems Biology 2019
Quote:
... the mouse was mounted onto a stereotaxic instrument (RWD Life Science, USA). The syringe of 33 gauge (Hamilton ...
-
No products found
because this supplier's products are not listed.
Heather Swann, et al.,
bioRxiv - Biophysics 2020
Quote:
... and 1:5 dilution of goat anti-mouse IgG nanogold conjugates (BBI solutions, Crumlin ...
-
No products found
because this supplier's products are not listed.
Marc Schwab, et al.,
bioRxiv - Neuroscience 2020
Quote:
... As a detection system the Simple Stain MAX PO (MULTI) anti-mouse (Nichirei Biosciences) was used ...