Labshake search
Citations for Evrogen :
1 - 6 of 6 citations for Folate receptor alpha FOLR1 Mouse HEK293 His since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Biophysics 2021Quote: ... with the mutation C85A and C-terminal 6×His tag) was obtained as a synthetic gene from Evrogen (Russia) and introduced into the pET11 expression vector (Novagen ...
-
bioRxiv - Cell Biology 2022Quote: ... Mouse anti-Aub antibody (1:20) (Patil and Kai 2010) or mouse anti-mKate2 (Evrogen, 1:200) was added to the cleared lysate and incubated at 4°C for 2 h with rotation ...
-
bioRxiv - Cell Biology 2022Quote: ... and incubated with the antibody (mouse anti-GFP [Thermos Fisher Scientific, 3E6, 1:500] or mouse anti-mKate2 [Evrogen, AB233, 1:500]) overnight at 4°C ...
-
bioRxiv - Immunology 2022Quote: Mouse NKG2D short and long isoforms (NKG2D-S/L) and Ly49A were cloned into pTagGFP or pTagRFP (Evrogen), respectively ...
-
bioRxiv - Molecular Biology 2021Quote: A mouse codon-optimized version of the piggyBac transposase (PBase) was cloned in frame with the red fluorescent protein tagRFPt (Evrogen) into a pBroad3 vector (pBroad3_hyPBase_IRES_tagRFPt ...