-
No products found
because this supplier's products are not listed.
Lucy Wang, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-[folate(polyethylene glycol)-5000] folate-PEG5k-DSPE) was purchased from Nanocs (New York, USA). DOX HCl and NIRB free base were purchased from Tongchuan Pharma (Wujiang City ...
-
No products found
because this supplier's products are not listed.
Alexander B. Coley, et al.,
bioRxiv - Cancer Biology 2021
Quote:
Human embryonic kidney (HEK293) cell line was obtained from GenLantis (San Diego, CA) and cultured in MEM (Mediatech ...
-
No products found
because this supplier's products are not listed.
Hoa Quynh Do, et al.,
bioRxiv - Biochemistry 2021
Quote:
... and lipid-protein nanodiscs (MSP1D1-His-POPC, MSP1D1-His-DMPG, MSP1D1-His-DMPC, Cube Biotech) were used to solubilize in-situ synthesized PCFT ...
-
No products found
because this supplier's products are not listed.
Vincent Soubannier, et al.,
bioRxiv - Neuroscience 2019
Quote:
... human iPSC-derived astrocytes were incubated with tumour necrosis factor alpha (TNFa) (30 ng/ml; Cell Sciences; Newburyport, MA; Cat. No. CRT100B), interleukin alpha (IL-1a ...
-
No products found
because this supplier's products are not listed.
Rafaela Muniz de Queiroz, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... anti-integrin alpha-3 (cat#A02902) and anti-integrin alpha-2 (cat#A01933-2) were purchased from Boster Biological Technology ...
-
No products found
because this supplier's products are not listed.
Laurence Abrami, et al.,
bioRxiv - Cell Biology 2020
Quote:
... L-alpha-phosphatidylserine (Avanti polar lipids 840032C), and L-alpha-phosphatidylethanolamine (Avanti polar lipids 840026C ...
-
No products found
because this supplier's products are not listed.
Sophie L. Lewandowski, et al.,
bioRxiv - Cell Biology 2020
Quote:
... with an alpha plate reader (TECAN Spark). After the perifusion ...
-
No products found
because this supplier's products are not listed.
Lyra O. Randzavola, et al.,
bioRxiv - Immunology 2022
Quote:
... HEK293-F were transfected with polyethylenimine (Polyscience Europe GmbH) at a ratio of 1:3 DNA:polyethylenimine (Tom et al. ...
-
No products found
because this supplier's products are not listed.
Luis Alfonso Yañez Guerra, Meet Zandawala,
bioRxiv - Evolutionary Biology 2023
Quote:
... HEK293-G5a (Angio-proteomie CAT no. cAP0200GFP-AEQ-Cyto) cells were cultured in 96 well-plates containing 100μl of DMEM (Thermo ...
-
No products found
because this supplier's products are not listed.
Lisa Koshko, et al.,
bioRxiv - Neuroscience 2023
Quote:
... or alpha MSH (rabbit, Phoenix Pharmaceuticals INC, 1:1000) primary antibody ...
-
No products found
because this supplier's products are not listed.
Jaime A. Freire-Arvelo, et al.,
bioRxiv - Neuroscience 2024
Quote:
... Optical density of D2 receptors of each sample was obtained using Odyssey software (LI-COR Biosciences), normalized against background ...
-
No products found
because this supplier's products are not listed.
Ben S. Ou, et al.,
bioRxiv - Immunology 2023
Quote:
... Heat Inactivated fetal bovine serum (HI-FBS) was purchased from Atlanta Biologicals. IFN-α cytokine enzyme-linked immunosorbent assay (ELISA ...
-
No products found
because this supplier's products are not listed.
Niko Schwenzer, et al.,
bioRxiv - Cell Biology 2024
Quote:
HEK293 cells with constitutive expression of CaV subunits β3 and α2δ1 and inducible expression of α1D (Charles River Laboratories CT6232) were cultured in DMEM/F12 medium containing selection antibiotics and 0.6 µM isradipine (Sigma I6658) ...
-
No products found
because this supplier's products are not listed.
Katharina Hoette, et al.,
bioRxiv - Cell Biology 2019
Quote:
... Isolation of organoids from the embedding matrix (human hepatic organoids: Matrigel, Corning; human pancreatic organoids: Cultrex BME2, Amsbio) for fixation and whole-mount staining was performed with slight modifications of protocols published by Broutier et al ...
-
No products found
because this supplier's products are not listed.
Diego Gilioli, et al.,
bioRxiv - Cancer Biology 2022
Quote:
... 10% Human Serum (cat#ECS0219D from Euroclone) and IL-2 (cat#F027131010 from Novartis ...
-
No products found
because this supplier's products are not listed.
Yukiko Yamaguchi, et al.,
bioRxiv - Immunology 2022
Quote:
... containing 100 U/mL recombinant human IL-2 (rhIL-2, Novartis Oncology) and 0.5 ng/mL recombinant human IL-15 (rhIL-15, CellGenix). For CAR lentiviral transduction ...
-
No products found
because this supplier's products are not listed.
Nicholas B. Karabin, et al.,
bioRxiv - Bioengineering 2020
Quote:
... Pooled human plasma was acquired from Zen-Bio Inc ...
-
No products found
because this supplier's products are not listed.
Lars Gruber, et al.,
bioRxiv - Biochemistry 2023
Quote:
Monoculture and biculture spheroids of CCD-1137Sk human fibroblasts and HT-29 human colon cancer cells (both LGC Standards, Wesel, Germany) were prepared ...
-
No products found
because this supplier's products are not listed.
Myung Chung, et al.,
bioRxiv - Neuroscience 2024
Quote:
... HEK293-EGFP (GenTarget, Cat. No. #SC001), and NIH-3T3 (originally obtained from Riken Bioresource Research Center and gifted from Dr ...
-
No products found
because this supplier's products are not listed.
María L. Franco, et al.,
bioRxiv - Biochemistry 2021
Quote:
The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
No products found
because this supplier's products are not listed.
Maali AlAhmad, et al.,
bioRxiv - Cell Biology 2024
Quote:
... HEK293-TRPM2tet cells grown in 96-well plates (Sarstedt) were preloaded with 1 µM Fura-2-AM/ 0.02% Pluronic® F127 (P-3000MP ...
-
Mirvetuximab (Anti-FOLR1) is a monoclonal antibody targeting FOLR1 (folate receptor 1)....
Cat# A2491, SKU# A2491-1mg,
1mg, $370.00
Ask
Richard Kanyo, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... Receptor inhibitors AM251 (Selleck Chemicals, Houston, TX, USA) and AM630 (Adooq Bioscience ...
-
No products found
because this supplier's products are not listed.
Jun Kunimatsu, Hidetoshi Amita, Okihide Hikosaka,
bioRxiv - Neuroscience 2023
Quote:
... a tungsten electrode (Alpha Omega Engineering or FHC) was lowered into the striatum through a guide tube using a micromanipulator (MO-97S ...
-
This Fibronectin solution has been purified from human plasma where it is found as a dimer and...
Cat# 5050-1MG,
1 mg, USD $135.0
Ask
Lauren J. Lahey, et al.,
bioRxiv - Biochemistry 2020
Quote:
HEK293 cell lines were seeded in PurCol-coated (Advanced BioMatrix) 6-well plates at 300,000 total cells in 2 mL media one day before transfection ...
-
No products found
because this supplier's products are not listed.
Agustina Rimondi, et al.,
bioRxiv - Microbiology 2022
Quote:
... Sera were treated with receptor-destroying enzyme (Accurate Chemical and Scientific Corp. ...
-
No products found
because this supplier's products are not listed.
Jing Zhao, et al.,
bioRxiv - Plant Biology 2023
Quote:
... His-tag antibody (Tiangen, Beijing, China) and GST antibody (Tiangen).
-
No products found
because this supplier's products are not listed.
Yanzhou Zhang, et al.,
bioRxiv - Cell Biology 2021
Quote:
His-tagged or His-sumo-tagged protein was purified using NiNTA beads (Anatrace, Cat. No. SUPER-NINTA25). Briefly ...
-
No products found
because this supplier's products are not listed.
Pavel Shekhtmeyster, et al.,
bioRxiv - Neuroscience 2021
Quote:
... This vector was co-transfected into HEK293-AAV cells (Vector Biolabs) along with a pAdeno-helper vector and a pRC-AAV9 rep-cap plasmid ...
-
No products found
because this supplier's products are not listed.
Carlo Dal Lin, et al.,
bioRxiv - Cell Biology 2020
Quote:
... mouse anti-alpha-tubulin (α-tubulin) (EXBIO Praha, Czech Republic) diluted 1:500 ...
-
No products found
because this supplier's products are not listed.
Siran Zhu, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... 150 pmol of 6×His-streptavidin (ProteoGenix) was mixed with 5 μl of sieved beads (10% ...
-
No products found
because this supplier's products are not listed.
Bryan J. González, et al.,
bioRxiv - Cell Biology 2021
Quote:
... and 2 µM R428 (Tyrosine kinase receptor AXL inhibitor) (ApexBio, A8329). From d1 to d11 media was changed every day and from d12 to d27 media was changed every other day ...
-
No products found
because this supplier's products are not listed.
Harsharan Singh Bhatia, et al.,
bioRxiv - Bioengineering 2021
Quote:
... and 0.4% Vol vitamin E (DL-alpha-tocopherol, Alfa Aesar, A17039), for at least 6 hours at room temperature until achieving transparency.
-
No products found
because this supplier's products are not listed.
Lucia Gonzalo, et al.,
bioRxiv - Plant Biology 2021
Quote:
... 4°C and the supernatants were incubated overnight with 1/100 RNAPII or HIS antibodies (RNAP II AS11 1804, HIS AS20 4441, Agrisera) and 30 μl SureBeads (BioRad) ...
-
No products found
because this supplier's products are not listed.
Mayis Kaba, et al.,
bioRxiv - Cell Biology 2022
Quote:
... Alpha Fluor 488 amine (20 μg/mL, AAT Bioquest/Cat No. 1705) was added at room temperature for 30 min with agitation before overnight incubation with hIgG ...
-
No products found
because this supplier's products are not listed.
Ana Zúñiga, et al.,
bioRxiv - Synthetic Biology 2019
Quote:
... into 500μL of Azure Hi-Def medium (Teknova, 3H5000) supplemented with 0.4% of glycerol ...
-
No products found
because this supplier's products are not listed.
Krishnapriya Hari, et al.,
bioRxiv - Neuroscience 2021
Quote:
... including anti-α5 GABAA receptor subunit (AAP34984, Aviva Systems Biology, San Diego, USA), anti-α1 GABAA receptor subunit (224-2P ...
-
No products found
because this supplier's products are not listed.
Julia A Alvarez, et al.,
bioRxiv - Microbiology 2024
Quote:
... 20% heat inactivated (HI) fetal bovine serum (FBS) (Omega Scientific), 1% penicillin-streptomycin (Life Technologies ...
-
Recombinant Antigen
Cat# REC31793-100,
100µg USD $451.0
Ask
Maya Imbrechts, et al.,
bioRxiv - Immunology 2021
Quote:
... Spike Glycoprotein (Full-Length)-His (REC31868-500, The Native Antigen Company). Briefly ...
-
No products found
because this supplier's products are not listed.
Sohail Jahid, et al.,
bioRxiv - Molecular Biology 2021
Quote:
... His-Cdc42 was instead dialyzed with 20 µM GppNHp (Jena Bioscience) in the presence of 5 U of Quick-CIP alkaline phosphatase (New England Biolabs) ...
-
No products found
because this supplier's products are not listed.
Einat Bigelman, et al.,
bioRxiv - Cell Biology 2022
Quote:
... which recognizes the native form of the extracellular portion of the receptor (Biorbyt, England, clone orb399781) followed by flow cytometry analysis.
-
No products found
because this supplier's products are not listed.
Somboon Wankanit, et al.,
bioRxiv - Molecular Biology 2024
Quote:
A total of 350,000 HEK293-T cells were seeded in each well of 6-well plates (#EP0030720113, Eppendorf). Transfection was performed the day after at 40-50% cell confluence ...
-
No products found
because this supplier's products are not listed.
Jan Steinkühler, et al.,
bioRxiv - Biophysics 2020
Quote:
... Human Transferrin – CF488A (Biotium) at 130 nM ...
-
No products found
because this supplier's products are not listed.
Vicente José Planelles-Herrero, et al.,
bioRxiv - Biochemistry 2023
Quote:
... a mix containing 50 μM taxol and 30 nM anti poly glutamylated alpha tubulin (GT335, AdipoGen Life Sciences) labelled with ATTO565 in imaging buffer was injected ...
-
No products found
because this supplier's products are not listed.
Peng Zhang, et al.,
bioRxiv - Cell Biology 2023
Quote:
... Keigi Fujiwara (University of Texas MD Anderson Cancer Center, Houston, TX) and IP3R1-null HEK293 cells (Kerafast, Inc., Boston, MA) (Alzayady ...
-
No products found
because this supplier's products are not listed.
Saurabh Srivastava, et al.,
bioRxiv - Molecular Biology 2021
Quote:
The optimal receptor-binding domain (OBD) (100, 100) of Tetanus Toxin (Heavy Chain/B Subunit) was synthesized by GENEWIZ (incorporating flanking 5’ Hindlll and 3’ Nco1 restriction sites ...
-
No products found
because this supplier's products are not listed.
Balaji Karthick Subramanian, et al.,
bioRxiv - Pathology 2019
Quote:
... Human primary podocytes from Celprogen Inc ...
-
No products found
because this supplier's products are not listed.
Manuel Göpferich, et al.,
bioRxiv - Neuroscience 2020
Quote:
... human FGF (20 ng/μl, ReliaTech) and human EGF (Promokine) ...
-
No products found
because this supplier's products are not listed.
Parker C. Wilson, et al.,
bioRxiv - Genomics 2022
Quote:
... Antibodies were added to each sample (0.5μg of rabbit glucocorticoid receptor antibody [abcam, ab225886, 1:20] or rabbit IgG negative control antibody [Epicypher, 13-0041k, 1:50]). The remaining steps were performed according to manufacturer’s instructions ...
-
No products found
because this supplier's products are not listed.
V. Praveen Chakravarthi, et al.,
bioRxiv - Developmental Biology 2020
Quote:
... 30 IU of human chorionic gonadotropin (hCG; BioVendor) was injected intraperitoneally ...
-
No products found
because this supplier's products are not listed.
Qinghui Wang, et al.,
bioRxiv - Immunology 2022
Quote:
... Naïve CD3 human T cells were purchased from HemaCare (Lot #21068415). N/TERT-1 cells were a gift from the Rheinwald Lab (Dickson et al. ...