-
No products found
because this supplier's products are not listed.
Robert W. Robey, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... and 17-AAG were purchased from ChemieTek (Indianapolis, IN). Romidepsin was obtained from Selleck Chem (Houston ...
-
No products found
because this supplier's products are not listed.
Bo Liang, et al.,
bioRxiv - Microbiology 2020
Quote:
... ethanol (CAS 64-17-5) (Spectrum Chemicals, New Brunswick, NJ) was used as supplied ...
-
No products found
because this supplier's products are not listed.
Anne-Emmanuelle Foucher, et al.,
bioRxiv - Biochemistry 2022
Quote:
... The aligned sample contained 17 mg/mL Pf1 phage (Asla Biotech). RDC-based intervector projection angle restraints used Da and R values of 8 and 0.33 ...
-
LC Laboratories' Product Number B-1722 - Bosutinib Isomer 1, Free Base (CAS 1391063-17-4), >99%...
Cat# B-1722, SKU# B-1722_50mg,
50 mg, $55.00
Ask
Victor Latorre, Ron Geller,
bioRxiv - Microbiology 2022
Quote:
... and the hsp90 inhibitor 17-DMAG (CA 467214-20-6; LC Laboratories) were dissolved in DMSO and resazurin (CAS ...
-
No products found
because this supplier's products are not listed.
Melissa E Lenert, Michael D Burton,
bioRxiv - Neuroscience 2023
Quote:
... and 100% anhydrous ethanol (Decon Laboratories, CAS#64-17-5, Cat#2701). The mice were heavily sedated using isoflurane (5% induction ...
-
No products found
because this supplier's products are not listed.
Olga Ponomarchuk, et al.,
bioRxiv - Cell Biology 2024
Quote:
... and cultured in CnT-17 medium (CellnTec Advanced Cell Systems, Bern, CH) until 80% confluence was reached ...
-
No products found
because this supplier's products are not listed.
Sebastian Bothe, et al.,
bioRxiv - Biochemistry 2022
Quote:
One fragment (ID5) reported to bind to the N-domain [26] could be purchased from Enamine and was tested as a positive control ...
-
No products found
because this supplier's products are not listed.
Catherine N. Russell, et al.,
bioRxiv - Biochemistry 2023
Quote:
... The sample was lysed by French press at 17 KPsi (Constant Systems Ltd), and any remaining sample washed with 15 ml lysis buffer ...
-
No products found
because this supplier's products are not listed.
Liangxia Ai, et al.,
bioRxiv - Immunology 2022
Quote:
... HEK 293T/17 (ATCC) and ACE2-expressing 293T cells (Zhejiang Meisen Cell Technology Co., Ltd) were cultured in Dulbecco’s Modified Eagle’s Medium (DMEM ...
-
No products found
because this supplier's products are not listed.
Yosef Fichman, et al.,
bioRxiv - Plant Biology 2022
Quote:
... The resulting RbohD sequence without its regulatory domain was cloned into pCAMBIA2301 vectors (Marker Gene Technologies, Eugene, OR, USA) downstream of the native RbohD promoter (Nühse et al. ...
-
No products found
because this supplier's products are not listed.
Joshua J. Kellogg, et al.,
bioRxiv - Microbiology 2023
Quote:
... 17 mL of culture was added to 20 mL serum bottles (Wheaton, actual volume 28 mL). Bottles were sealed using a vial crimper with rubber caps (Wheaton ...
-
No products found
because this supplier's products are not listed.
Tomoyuki Hatano, et al.,
bioRxiv - Cell Biology 2021
Quote:
... The interaction between the protein products fused to the DNA binding and activation domains were analyzed by the activity of β-galactosidase by the cleavage of X-Gal (BIO-37035, Bioline, UK). For detecting the β-galactosidase activity overlaying of low melting agarose with X-Gal (over lay mix was prepared freshly) ...
-
No products found
because this supplier's products are not listed.
Vincent Panneton, et al.,
bioRxiv - Immunology 2022
Quote:
... mice were injected intraperitoneally with 100µg of 4-Hydroxy-3-nitrophenylacetyl hapten-17 (NP17)-OVA (Biosearch Technologies, 1µg/mL) mixed with Imject Alum (ThermoFisher ...
-
No products found
because this supplier's products are not listed.
Zhaoqian Wang, et al.,
bioRxiv - Biochemistry 2023
Quote:
... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
X antigen family member 1 (17-32) is a bioactive peptide of X antigen family member 1. The...
Cat# BAT-009806,
Inquire
Ask
M Carter, et al.,
bioRxiv - Genetics 2020
Quote:
... and grown in HMI-9 medium containing Dox (when appropriate) plus melarsoprol at 17 nM or 35 nM melarsoprol (BoC sciences, CAS 494-79-1). Melarsoprol stocks were diluted in DMSO and cultures treated for the indicated duration (Fig ...
-
No products found
because this supplier's products are not listed.
Jing Zhao, et al.,
bioRxiv - Plant Biology 2023
Quote:
... and GST antibody (Tiangen).
-
No products found
because this supplier's products are not listed.
Bailey E. McGuire, et al.,
bioRxiv - Microbiology 2021
Quote:
Rabbit polyclonal antibodies (Kinexus Bioinformatics) directed against synthetic peptides based on SARS-CoV-2 proteins were used in dot blots and are as follows ...
-
No products found
because this supplier's products are not listed.
Qian Guo, et al.,
bioRxiv - Cell Biology 2024
Quote:
... goat polyclonal antibody EEA1 (A121550, Antibodies.com) (1:200 for IF).
-
No products found
because this supplier's products are not listed.
Julia I. Ries, et al.,
bioRxiv - Microbiology 2022
Quote:
... The monoclonal anti-FD antibody was from BioPorto Diagnostics A/S ...
-
No products found
because this supplier's products are not listed.
Fei Mao, et al.,
bioRxiv - Neuroscience 2021
Quote:
... anti-GAPDH antibody (catalog # 2-RGM2, Advanced ImmunoChemical) was used at 1 μg/mL.
-
No products found
because this supplier's products are not listed.
Zsuzsa Csobán-Szabó, et al.,
bioRxiv - Biochemistry 2021
Quote:
... Polyclonal antibody to human epidermal transglutaminase (TG3) (Zedira) (1/2000) ...
-
No products found
because this supplier's products are not listed.
Jérémie Courraud, et al.,
bioRxiv - Genetics 2022
Quote:
... specific primary antibodies were used: anti-UPF3B (NSJ BIOREAGENTS), anti-PQBP1 (NOVUSBIO) ...
-
No products found
because this supplier's products are not listed.
Stéphane Pillet, et al.,
bioRxiv - Immunology 2021
Quote:
... SARS-CoV NP primary antibody (EastCoast Bio; ME, USA) and a Goat Anti-Mouse IgG conjugate antibody (Fitzgerald ...
-
No products found
because this supplier's products are not listed.
Lei Liu, et al.,
bioRxiv - Immunology 2022
Quote:
... The following antibodies were used: anti-CD11b (Biogems, CA), anti-F4/80 (Biolegend ...
-
No products found
because this supplier's products are not listed.
M.M. Joglekar, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... VCAN (1:200, Mouse Anti-Versican Antibody 2B1, Seikagaku), and ELN (1:400 ...
-
No products found
because this supplier's products are not listed.
Mayank Verma, et al.,
bioRxiv - Developmental Biology 2021
Quote:
... 1 µg/ml anti-FLT1 monoclonal antibody (Angio-Proteomie, MAB7072), inhibitors of FLK1 ...
-
No products found
because this supplier's products are not listed.
Tali Kiperman, et al.,
bioRxiv - Developmental Biology 2023
Quote:
... Antibodies used were diluted in 5% milk (Labscientific CN: M0841). Primary and secondary antibodies with dilutions used are described in Suppl ...
-
No products found
because this supplier's products are not listed.
Transito Garcia-Garcia, et al.,
bioRxiv - Microbiology 2020
Quote:
... Antibodies against the HA and SNAP epitope were purchased from Osenses and New England BioLabs ...
-
No products found
because this supplier's products are not listed.
Fabrizio Clarelli, et al.,
bioRxiv - Biochemistry 2019
Quote:
... Primary antibodies raised against GyrA (Rabbit α-Gyrase A, PA005, Inspiralis), GyrB (Rabbit α-Gyrase B ...
-
No products found
because this supplier's products are not listed.
Michelle Zuo, et al.,
bioRxiv - Immunology 2021
Quote:
... magnetic beads were conjugated with monoclonal capture antibodies (mAB47:3, UmanDiagnostics), incubated with diluted mouse serum (1:8 or 1:16 dilution ...
-
No products found
because this supplier's products are not listed.
Jasmina Büchel, et al.,
bioRxiv - Cancer Biology 2023
Quote:
... and anti-O6-me-dG antibody (Squarix, EM 2-3, SQM003.1) were used in addition to Dynabeads™ Protein G for Immunoprecipitation (Invitrogen™ ...
-
No products found
because this supplier's products are not listed.
Airi Tarutani, et al.,
bioRxiv - Neuroscience 2023
Quote:
... Secondary antibodies were conjugated to 5 nm gold particles (Cytodiagnostics, 1:50). Immunostained grids were negatively stained with 2% phosphotungstic acid and dried ...
-
No products found
because this supplier's products are not listed.
Andrew Wishart, et al.,
bioRxiv - Cancer Biology 2020
Quote:
... inhibitory antibody or drug and plated on glass-bottomed dishes (MatTek, Ashland, MA) coated with 20μg/ml ECM protein and allowed to adhere for 2 hours ...
-
No products found
because this supplier's products are not listed.
Asish K Ghosh, et al.,
bioRxiv - Pharmacology and Toxicology 2021
Quote:
... and subjected to western blotting using antibodies against PAI-1 (Molecular Innovations, Inc.), type I collagen (Southern Biotech) ...
-
No products found
because this supplier's products are not listed.
Michelle E. Poling, et al.,
bioRxiv - Physiology 2022
Quote:
... were incubated overnight at 4C with coating antibody (Cat# ACT-CM-GFPTRAP, Allele Biotechnology) diluted in 0.01M pH8.0 bicarbonate buffer at a concentration of 1μg/ml ...
-
No products found
because this supplier's products are not listed.
Scott Birks, et al.,
bioRxiv - Bioengineering 2023
Quote:
... prior to being tagged with a rabbit anti-nesprin2 antibody (1:300; ImmuQuest IQ565). After primary antibody tagging ...
-
No products found
because this supplier's products are not listed.
Juliana E. Gentile, et al.,
bioRxiv - Molecular Biology 2023
Quote:
... Primary antibodies were diluted in LICOR TBS blocking buffer + 0.2% Tween-20 (Teknova, cat no. T0710) and incubated at 4°C overnight ...
-
No products found
because this supplier's products are not listed.
Rosalie Martel, et al.,
bioRxiv - Bioengineering 2022
Quote:
Antibody microarrays were patterned on PolyAn 2D-Aldehyde slides (PolyAn) using the sciFLEXARRAYER SX inkjet bioprinter (Scienion). Slide were imaged in the 532 nm channel at 100% gain prior to patterning to qualitatively assess the uniformity of the aldehyde functionalization ...
-
No products found
because this supplier's products are not listed.
Fan Liu, et al.,
bioRxiv - Neuroscience 2022
Quote:
... The corresponding secondary antibodies (HRP-conjugated goat anti-rabbit or goat anti-mouse, 1:5000, CoWin Biosciences) were probed for 1 h at room temperature ...
-
No products found
because this supplier's products are not listed.
Sophie E. Cousineau, et al.,
bioRxiv - Microbiology 2022
Quote:
... slides were fixed in 100% acetone and stained with anti-HCV core antibody (1:100, clone B2, Anogen), and subsequently with the AlexaFluor-488-conjugated anti-mouse antibody (1:200 ...
-
No products found
because this supplier's products are not listed.
Assunta Senatore, et al.,
bioRxiv - Neuroscience 2020
Quote:
... The following antigens were coated on separate 384-well ELISA plates: anti-Fd antibody (The Binding Site GmbH) 1:1000 in PBS ...
-
No products found
because this supplier's products are not listed.
Jayne E. Wiarda, et al.,
bioRxiv - Immunology 2022
Quote:
... mouse α-pig γδTCR-iFluor594 (primary antibody Washington State University PG2032; custom conjugation to iFluor594 performed by Caprico Biotechnologies); mouse α-pig CD4-PerCP-Cy5.5 (BD 561474) ...
-
No products found
because this supplier's products are not listed.
Amanda P. Waller, et al.,
bioRxiv - Pathology 2020
Quote:
... membranes were incubated overnight at 1:2000 in primary antibody (Anti-murine Prothrombin, Haematologic Technologies Inc, Essex Junction, VT) followed by corresponding secondary antibody conjugated to horseradish peroxidase ...
-
17-Hydroxyprogesterone ELISA / assay Kit
Cat# K053-H5,
1.0 ea, USD $1810.0
Ask
Moisés dos Santos Corrêa, et al.,
bioRxiv - Animal Behavior and Cognition 2019
Quote:
... which allows detection of specific antibodies in blood plasma using the Corticosterone Enzyme Immunoassay Kit (Arbor Assays LLC, MI, USA). This kit is supplied with clear plastic microtiter plates coated with donkey anti-sheep IgG ...
-
No products found
because this supplier's products are not listed.
Robert G. Orr, et al.,
bioRxiv - Cell Biology 2019
Quote:
... The myosin XIa-CCT antibody was developed against a 6xHis fusion of the myosin XIa-CCT (Capralogics, Inc. Hardiwick, MA).
-
No products found
because this supplier's products are not listed.
Jacqueline M. Tokarew, et al.,
bioRxiv - Neuroscience 2020
Quote:
... A 0.4 % horseradish peroxidase solution was prepared using HRP-linked anti-rabbit secondary antibody diluted in Stabilizyme solution (SurModics SZ02). Each read was set up in triplicate on a white polystyrene 96-well plate (ThermoFisher 236105 ...
-
No products found
because this supplier's products are not listed.
Emanuel Rognoni, et al.,
bioRxiv - Cell Biology 2021
Quote:
... blocked with 5% BSA/PBS (1 h at room temperature) and stained with the indicated primary antibodies and 5 µM B-CHP (BIO300, 3Helix) overnight at 4°C ...
-
No products found
because this supplier's products are not listed.
Zhengtang Qi, et al.,
bioRxiv - Molecular Biology 2020
Quote:
... The membrane was blocked for 1 h at room temperature followed by incubation overnight at 4°C with primary antibodies including FAM132b (AVISCERA BIOSCIENCE), PI3K ...
-
No products found
because this supplier's products are not listed.
Daiana Martire-Greco, et al.,
bioRxiv - Immunology 2021
Quote:
... conditioned media (CM) were collected and incubated for 2 h with an anti-Stx antibody (anti-Stx2 variant from Toxin Technology, USA) to block the direct effect of Stx ...
-
No products found
because this supplier's products are not listed.
Lesia Rodriguez, et al.,
bioRxiv - Plant Biology 2022
Quote:
... Proteins immunoprecipitated with anti-FLAG antibody were separated by SDS-PAGE (4-15% Mini-PROTEAN®TGX™ Precast Protein Gels (Bio-RAD)) ...