Labshake search
Citations for Biosynth International :
1 - 2 of 2 citations for Caspase Recruitment Domain Family Member 17 CARD17 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2023Quote: ... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
bioRxiv - Molecular Biology 2023Quote: ... The following antibodies were raised against the indicated peptides derived from Xenopus laevis proteins (New England Peptide now Biosynth): Dbn1 (Ac-CWDSDPVMEEEEEEEEGGGFGESA-OH) ...