Labshake search
Citations for GenScript :
151 - 200 of 330 citations for Saporin Chicken Polyclonal affinity purified Alexa488 labeled since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2021Quote: ... Purified antibody was produced by Genscript as human IgG in HD 293F mammalian cells ...
-
bioRxiv - Molecular Biology 2023Quote: ... supplemented with 45nM purified LwaCas13a (Genscript, stored in 100 mM Tris HCl pH 7.5 and 1 mM DTT) ...
-
bioRxiv - Microbiology 2022Quote: ... The resulting supernatant was then loaded onto a gravity column with 1 mL α-FLAG G1 affinity resin (Genscript), and the flow through was passed through the column four more times ...
-
bioRxiv - Molecular Biology 2023Quote: ... The sample was clarified by centrifugation at 30,000 rpm for 30 min and the supernatant was then incubated with anti-DYKDDDDK Affinity Beads (GenScript) for 3 h at 4°C ...
-
bioRxiv - Plant Biology 2023Quote: ... the supernatant was isolated by centrifugation at 80,000 × g for 1 h and incubated with Anti-DYKDDDDK G1 Affinity Resin (GenScript) at 4 °C for 30 min ...
-
bioRxiv - Molecular Biology 2021Quote: ... and a rabbit polyclonal antibody specific for calmodulin-binding peptide (A00635-40, GenScript), a Goat anti-Rabbit IgG (H+L ...
-
bioRxiv - Cell Biology 2019Quote: ... Rat polyclonal antibodies against full-length recombinant GST-tagged PfAlba3 were from GenScript Corporation ...
-
bioRxiv - Microbiology 2021Quote: ... using primary antibodies specific for MeV F HRC (rabbit polyclonal, Genscript, 503028-1) and 6xHis tag (rabbit polyclonal ...
-
bioRxiv - Microbiology 2021Quote: ... using primary antibodies specific for MeV F HRC (rabbit polyclonal, Genscript, 503028-1) and 6xHis tag (rabbit polyclonal ...
-
bioRxiv - Immunology 2021Quote: ... The full-length native chicken ovalbumin (OVA) gene inserted in a pcDNA3.1+ plasmid (clone ID: OGa28271) was purchased from GenScript. Gene inserts from pcDNA3.1+ plasmids were cloned into the pAM2AA backbone incorporating the liver-specific human α-1 antitrypsin promoter and human ApoE enhancer flanked by AAV2 inverted terminal repeats ...
-
bioRxiv - Biophysics 2022Quote: ... Biotin-labeled mouse monoclonal antibody against the Strep-tagII (“NWSHPQFEK”) was purchased from Genscript (GenScript Cat# A01737 ...
-
bioRxiv - Cell Biology 2020Quote: ... S100 supernatant was added directly to 600 μL of basic lysis buffer with protease inhibitors and NEM containing 30 μL 1:1 anti FLAG Affinity Gel (Genscript). All samples were incubated overnight at 4°C ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... The peptide was chemically synthesized with the addition of an extra Cys residue at the C-terminus (ML199816a, EEDSAFLFADC) to enable conjugation to KLH and used for immunization of rabbits followed by affinity purification by Genscript.
-
bioRxiv - Biophysics 2023Quote: The binding affinities of wild-type Clr6S and Rpd3S proteins to the synthesized H3K36me3 peptide (ATKAARKSAPATGGVK36(me3)KPHRYRPG) (GenScript Biotech) were determined using BIAcore T200 system (GE Healthcare ...
-
bioRxiv - Microbiology 2020Quote: ... and purified with protein A resin (GenScript) and by Ni-NTA resin (Thermo Fisher Scientific) ...
-
bioRxiv - Molecular Biology 2021Quote: ... KA83 triple mutations were purified by GenScript Biotech Corporation ...
-
bioRxiv - Neuroscience 2019Quote: ... was synthesized and HPLC-purified by Genscript USA Inc ...
-
bioRxiv - Developmental Biology 2020Quote: ... synthesized and purified by GenScript (Piscataway, NJ). The antigen sequence (MCFKCQQTGHFARECPNESAAGENGDRPKPVTYVPPTPTEDEEEMFRSTIQQGINFEKYDQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPHHHHHH ...
-
bioRxiv - Immunology 2021Quote: Purified SARS-CoV-2 S1 protein (GenScript) in carbonate buffer ...
-
Deletion or inhibition of PTPRO mitigates diet-induced hepatic steatosis and inflammation in obesitybioRxiv - Immunology 2022Quote: Phosphopeptides were synthesized and purified by GenScript Japan (Tokyo ...
-
bioRxiv - Cancer Biology 2022Quote: ... and purified with protein A resin (GenScript). Buffer replacement in protein purification used Column PD 10 desalting column (GE Healthcare) ...
-
bioRxiv - Biophysics 2023Quote: ... purified using anti-Flag resins (GenScript Biotech), and further purified using Heparin and size-exclusion chromatography (Superose 6 ...
-
bioRxiv - Biochemistry 2019Quote: ... we designed and purchased an anti-horse-SLN polyclonal antibody from Genscript (pAb GS3379). The immunogen was a 6-residue N-terminal peptide of horse SLN (Q1MEWRRE6C) ...
-
bioRxiv - Microbiology 2020Quote: ... EsxA and SodA were generated for this study (Customer’s Antigen Polyclonal Antibody Package, Genscript). C-terminally his6-tagged SiEsaA41-871 ...
-
bioRxiv - Microbiology 2021Quote: ... 0.2% Tween-20) for 30 min and probed with CaBcy1 rabbit polyclonal antibody (GenScript) or CaTpk2 rabbit polyclonal antibody (GenScript) ...
-
bioRxiv - Cell Biology 2022Quote: ... GiGrx5 and GiBolA proteins were detected by a rabbit anti-BAP polyclonal antibody (GenScript). Mitosomal GiTom40 and GiIscU were detected with a specific polyclonal antibody raised in rabbits (84) ...
-
bioRxiv - Microbiology 2023Quote: ... Membranes were probed with an anti-EsxA1 rabbit polyclonal antibody (0.5 μg/ml; GenScript) in the above LI-COR blocking buffer overnight at 4°C ...
-
bioRxiv - Immunology 2023Quote: ... A CM5 chip with covalently immobilized anti-Avi polyclonal antibody (GenScript, Cat #: A00674-40) was used for surface capture of His-Avi tag containing RBDs ...
-
bioRxiv - Genetics 2021Quote: ... rat anti-RAD-51 (1:500, (20)), guinea pig anti-SUN-1 S24pi (1:700, (72)), chicken anti-GFP (1:500, (A01694, Genscript)) ...
-
bioRxiv - Cell Biology 2021Quote: ... Mouse Tmod3 amino acid sequence with locations of peptides (red – Nterm, blue - Cterm) used to custom prepare chicken anti-Tmod3 antibodies (Genscript). A commercial rabbit anti-Tmod3 antibody (Aviva ...
-
bioRxiv - Biophysics 2020Quote: ... To determine the binding affinities between antigens and antibody mouse monoclonal anti-His-tag IgG (clone 6G2A9, The™ His tag Ab, GenScript) was captured on the surface of active flow cell to the level of 100-200 RU ...
-
bioRxiv - Biochemistry 2024Quote: ... The supernatant was cleared by centrifugation at 20,000 × g for 35 mins and loaded onto a gravity-flow column to incubate with anti-FLAG affinity resin (GenScript Biotech). The resin was washed with 15 column volumes of Wash Buffer containing 20 mM of HEPES (pH 7.4) ...
-
bioRxiv - Molecular Biology 2019Quote: ... Pre-cleared chromatin was incubated with 10 μg of anti-Sir3 polyclonal IgG antibody (Genscript) or anti-Rap1 polyclonal IgG antibody (Abcam ...
-
bioRxiv - Microbiology 2021Quote: Polyclonal Rabbit antibodies against the potential S-Layer protein of A_DKE were generated by GenScript Biotech B ...
-
bioRxiv - Microbiology 2021Quote: ... the membrane was incubated with 1:7000 polyclonal anti-Bma-LAD-2 peptide antibodies (Genscript) and 1:1000 rabbit anti-β actin antibodies (Abcam ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... custom polyclonal antibodies raised against recombinant fragment antigen generated by immunization of rabbits (GenScript, USA). The sequence of the recombinant fragment was ITGCLSLYDLKLIAAVMSCPVAQRHFETEEDKKDEDEDDRAEDPVDENPDDTITVSQMWQDF LHTLTLHGFRFVFERGPTHHHHHH ...
-
bioRxiv - Microbiology 2019Quote: ... Bands were identified using a commercial polyclonal serum against the histidine tag (#A00186-100 Genscript) and an anti-mouse secondary antibody (#170-6516 ...
-
bioRxiv - Plant Biology 2021Quote: ... the SGQKPLTLAEFTIGGSQ peptide was synthesized and polyclonal antiserum was raised in rabbit (GenScript, Tokyo, Japan). Anti-rabbit IgG horseradish peroxidase-linked antibody (Promega ...
-
bioRxiv - Molecular Biology 2020Quote: ... UhAVR1 was detected using a custom made antirabbit polyclonal antibody (anti-UhAVR1, GenScript USA Inc). The peptide used to make this antibody is described in Table S4 ...
-
bioRxiv - Neuroscience 2021Quote: ... rabbit polyclonal short XIRP2 antibody (custom generated against the immunizing peptide NSKRQDNDLRKWGD, Genscript, 1:100), mouse monoclonal IgG1 γ-actin antibody (1-24 ...
-
bioRxiv - Physiology 2022Quote: ... and incubated with a custom polyclonal primary antibody against coral soluble adenylyl cyclase (sAC; GenScript). This antibody was designed against sAC expressed by the coral Acropora digitifera (Barott et al. ...
-
bioRxiv - Plant Biology 2023Quote: ... then incubated with 1:1000 dilution of custom rabbit anti-IPD3 polyclonal antibody (Genscript, China) followed by 1:2,500 donkey anti-rabbit AlexaFluor 488- conjugated secondary antibodies (Thermo Fisher ...
-
bioRxiv - Microbiology 2023Quote: ... was used to amplify signals from anti-FimH polyclonal antibody (custom antibody produced by Genscript). Slides were counterstained using 10 mg/mL bisBenzimide H 33258 dissolved in TBS for 20 minutes in the dark at room temperature then cover slipped ...
-
bioRxiv - Microbiology 2023Quote: ... Primary antibodies for assay of transfected cells were goat polyclonal anti-HA (1:500, GenScript), and mouse monoclonal anti-FLAG (1:500 ...
-
bioRxiv - Microbiology 2020Quote: Commercially produced purified antigens were supplied by GenScript as follows ...
-
bioRxiv - Molecular Biology 2021Quote: ... Purified FMO-2 protein was purchased from GenScript. Purified FMO5 protein ...
-
bioRxiv - Immunology 2019Quote: ... Neoantigens were synthesized and HPLC purified by Genscript Inc (Nanjing ...
-
bioRxiv - Neuroscience 2020Quote: ... Nma1 and Nma1Δct (purified by GenScript (Piscataway, NJ) at varying concentrations (CS/protein ...
-
bioRxiv - Biophysics 2022Quote: ... MspA mutant M2-NNN19 was purified by Genscript. All experiments were conducted at 37±1 °C with 1 mM ATP ...
-
bioRxiv - Biochemistry 2023Quote: ... coli and purified using Ni-NTA chromatography (Genscript). AiEvo2 protein was complexed with guide RNA (IDT ...