Labshake search
Citations for GenScript :
251 - 300 of 659 citations for Recombinant human IgE kappa L His tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2023Quote: A pET-24 a (+) vector containing each codon optimized His-tagged sequence was ordered (Genscript) and transformed into E ...
-
bioRxiv - Molecular Biology 2023Quote: ... human IL11 (hIL11, Z03108, Genscript), mouse IL11 (mIL11 ...
-
bioRxiv - Molecular Biology 2023Quote: ... human AMPKγ3 (GenScript, NJ, USA) and mouse AMPKγ3 (Yenzym ...
-
bioRxiv - Microbiology 2019Quote: ... Bands were identified using a commercial polyclonal serum against the histidine tag (#A00186-100 Genscript) and an anti-mouse secondary antibody (#170-6516 ...
-
bioRxiv - Biochemistry 2021Quote: ... The C-terminal TwinStrep-HA tag (sequence TGGGGSGGGASWSHPQFEKGGSGGGSWSH PQFEKGGYPYDVPDYA*) was synthetized and cloned (by Genscript) between the EcoRI and BamHI sites of the pLVX-TetOne-Puro vector (631849 ...
-
bioRxiv - Immunology 2024Quote: All constructs contained a C-terminal histidine affinity tag and were codon optimized by GenScript for mammalian cell expression ...
-
bioRxiv - Cell Biology 2019Quote: ... Rat polyclonal antibodies against full-length recombinant GST-tagged PfAlba3 were from GenScript Corporation ...
-
bioRxiv - Molecular Biology 2023Quote: ... Recombinant BRD4 N-terminal protein was purchased from GenScript (BRD4-N (49-460aa), His ...
-
bioRxiv - Synthetic Biology 2023Quote: ... Some recombinants were generated by homologous recombination using GenBuilder Kit (GenScript Biotech Corporation) following manufacturer’s instructions.
-
bioRxiv - Bioengineering 2021Quote: ... GILTco1-m-ApoE1-L and GILTco1-m-ApoE2-L were designed using GenSmart™ Codon Optimization Tool (GenScript). Human GAA coding sequence variant GILTco2-m was designed using GeneArt codon optimization algorithm (Thermofisher Scientific) ...
-
bioRxiv - Biophysics 2021Quote: ... This was followed by several PBS wash steps and incubation with anti-His antibody (#25B6E11, Genscript) at a dilution of 1:500 for 1h in 0.1 % FBS/PBS ...
-
bioRxiv - Biophysics 2019Quote: ... His-tagged Xenopus laevis HAUS8 was used to produce rabbit polyclonal anti-HAUS8 anti-serum (Genscript). Alexa-647 labelled XenC antibody was generated by first dialyzing antibodies in PBS buffer (50mM NaPO4 ...
-
bioRxiv - Biophysics 2019Quote: ... anti-sera were generated against His-tagged HAUS1 and C-terminal fragment HAUS6 as well (Genscript). All custom-made antibodies were purified from serum with an antigen-coupled matrix (Affi-Gel 10 or 15 ...
-
bioRxiv - Microbiology 2020Quote: ... 60 or 100 nM of his/FLAG-tagged SARS-CoV-2 spike protein (GenScript, Z03481-100) was added to each well ...
-
bioRxiv - Molecular Biology 2021Quote: AngII and TRV023 (Sar-Arg-Val-Tyr-Lys-His-Pro-Ala-OH) were synthesized by GenScript USA (Piscataway ...
-
bioRxiv - Immunology 2020Quote: ... Biotin-Protein L was purchased from GenScript. BsiWI was purchased from New England Biolabs ...
-
bioRxiv - Cell Biology 2020Quote: Sequences of full length hsRIPK2 with an N-terminal 3x-Flag tag were synthesized by Genscript and cloned into doxycycline-inducible lentiviral expression vectors (pF_TRE3G_rtTAAd_puro (Takara Bio)) ...
-
bioRxiv - Biochemistry 2020Quote: ... archaeon HeR gene (GenBank ID: KYK26602.1) containing an N-terminal histidine-tag was chemically synthesized (GenScript) and subcloned into the pET21a (+)-vector ...
-
bioRxiv - Biophysics 2020Quote: ... Lentiviral vector pAIP-NSP2-SNAP was generated using a synthetic SNAP tag-coding DNA (GenPart, Genscript) inserted into a double digested with MluI/EcoRI pAIP-NSP2-mCherry vector16 ...
-
bioRxiv - Neuroscience 2021Quote: ... and a FLAG-HA tag in-frame with the sORF protein sequence was synthesized by Genscript and cloned into an FUGW overexpression vector (Addgene #14883) ...
-
bioRxiv - Immunology 2019Quote: 96-well plates were coated overnight at 4°C with mouse anti-Avi-tag antibody (Genscript) at 2 μg/ml in PBS ...
-
bioRxiv - Cell Biology 2022Quote: ... transferred to nitrocellulose membrane and the protein tags were detected by rabbit anti-BAP antibody (Genscript) and rat anti-HA antibody (Roche) ...
-
bioRxiv - Cell Biology 2023Quote: ... The N-terminal 3xFlag tag was removed by incubation with the GST tagged Prescission Protease (GenScript) (final 0.01U/ul ...
-
bioRxiv - Biochemistry 2023Quote: ... wild-type OGG1 was expressed with a GST tag from a pGEX-6P1clone purchased from GenScript. The plasmid was transformed into T7 Express plysS Competent E ...
-
bioRxiv - Synthetic Biology 2023Quote: ... diluted to OD of 0.1 – 0.3 and stained with THETM iFluor 647 HA Tag antibody (GenScript; 1:500 – 1:1,000 dilution of 0.5 mg/ml stock in 10 mg/ml BSA ...
-
bioRxiv - Microbiology 2023Quote: The full recombinant MPL36 protein (rMPL36/aa 41-321) was commercially produced by GenScript® Biotech with His-tag in an E ...
-
bioRxiv - Cell Biology 2023Quote: The pcDNA3.1-NR2A (catalog #: OHu24642D, NM_000833, human) and the pcDNA3.1-NR1 (catalog #: OHu22255D, NM_007327, human) plasmids were purchased from GenScript. The pcDNA3.1-BiP plasmid was provided by Dr ...
-
bioRxiv - Biochemistry 2019Quote: ... P116A/Y117Q and P142A/Y143Q mutants with a C terminal FLAG tag were synthesized by Genscript (genscript.com).
-
bioRxiv - Immunology 2019Quote: 96-well ELISA plates were coated overnight at 4°C with mouse anti-Avi-tag antibody (Genscript) at 2 μg/ml in PBS ...
-
bioRxiv - Neuroscience 2022Quote: ... codon optimized mouse Pcbp2 clone with N-terminal Flag epitope tag was produced by gene synthesis (Genscript) and cloned in pcDNA3.1 (Invitrogen).
-
bioRxiv - Cell Biology 2023Quote: ... an SBP tag and the mRFP coding sequence was synthesized and cloned into pUC57-KanR (GenScript Inc.) and subcloned as an EcoRI-XBaI fragment into pUASTattB (Bischof et al. ...
-
bioRxiv - Physiology 2024Quote: ... Human HSD17B13 (NCBI Accession number: NM_178135.5) with HA-tag on the C-terminus was cloned into pcDNA3.1 (Genscript). HEK293 cells and HepG2 cells were transfected with HSD17B13 or empty control vector using Lipofectamine 2000 ...
-
bioRxiv - Biochemistry 2023Quote: ... NM_032643.4) was cloned into the pcDNA3.1+/C-(K)-DYK vector with a C-terminal FLAG tag (GenScript). The cDNA of human STK25 isoform 1 (RefSeq accession no ...
-
bioRxiv - Bioengineering 2021Quote: ... 2 mM CaCl2) using 10 U of Recombinant Bovine His6-Enterokinase (GenScript, Piscataway, NJ, USA) overnight at room temperature ...
-
bioRxiv - Biochemistry 2022Quote: cDNA constructs for expression of recombinant Mac-1 in mammalian cells were generated by GenScript. ITGAM cDNA was cloned into the vector pcDNA3.1/HygroB(+) ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... custom polyclonal antibodies raised against recombinant fragment antigen generated by immunization of rabbits (GenScript, USA). The sequence of the recombinant fragment was ITGCLSLYDLKLIAAVMSCPVAQRHFETEEDKKDEDEDDRAEDPVDENPDDTITVSQMWQDF LHTLTLHGFRFVFERGPTHHHHHH ...
-
bioRxiv - Microbiology 2023Quote: ... enterica Tsr LBD construct for recombinant protein expression was performed as a service by Genscript Biotech Corp ...
-
bioRxiv - Molecular Biology 2021Quote: ... All purification steps were monitored either by Coomassie-stained SDS-PAGE or anti-HIS western blot (Genscript #A00186). HMT assays were essentially performed as described in (Frapporti et al. ...
-
bioRxiv - Cell Biology 2021Quote: N-terminally Histidine (His)-tagged Bin1b SH3 from zebrafish was cloned into pET-28a (+) expression vector (GenScript®). Full length zebrafish Cavin4a (Cavin4a-FL ...
-
bioRxiv - Microbiology 2020Quote: ... and then incubated with 45 μL each of 0.1 μg/mL of THE anti-his-HRP (GenScript, A00612) in PBST/BSA for 1 hr at room temperature ...
-
bioRxiv - Cell Biology 2021Quote: Codon optimized human SHIP164 generated by Genscript was amplified using PCR from the pUC57 plasmid and ligated into various mammalian and bacterial expression plasmids ...
-
bioRxiv - Genomics 2021Quote: ... human Hek293 DNA was purchased from Genscript. S ...
-
bioRxiv - Neuroscience 2022Quote: Human Stathmin expression clones were from Genscript (STMN1-OHu14092D ...
-
bioRxiv - Biophysics 2022Quote: Isoform 1 of human SERINC2 (GenScript-OHu23082D) was cloned into pFastBacI with the TEV and STREP cleavage and affinity tags upstream of the gene encoding hSERINC2 ...
-
bioRxiv - Microbiology 2020Quote: The fusion construct comEC-Twin strep tag (plasmid pED2385) was generated from a synthesized fragment purchased from Genscript USA that contained two strep tag II sequences ...
-
bioRxiv - Neuroscience 2021Quote: ... St3-Halo was generated by replacing the GFP in St3-GFP with Halo tag (GenScript USA Inc, NJ). The following reagents were used ...
-
bioRxiv - Biochemistry 2020Quote: ... Full-length codon-optimized yeast HSP104 fused C-terminally to an HA-tag was expressed from pcDNA3.1 (Genscript). Human codon-optimized HSPH1 fused C-terminally to a Myc-tag was expressed from pcDNA3.1 (Genscript) ...
-
bioRxiv - Microbiology 2021Quote: The CAN97-83 HMPV N0-P construct with a 6X C-terminal His6-tag was synthesized by GenScript in the pET-29b(+ ...
-
bioRxiv - Neuroscience 2020Quote: ... St3-Halo was generated by replacing the GFP in St3-eGFP with Halo tag (GenScript USA Inc, NJ). The following reagents were used ...
-
bioRxiv - Molecular Biology 2023Quote: ... basic coil motif (AQCKKKLQALKKKNAQLKWKLQALKKKLAQ) and 6xHIS tag inserted into a pcDNA3.1-Hygro(-)-like backbone was synthesized commercially (GenScript). The region encoding the α4 ectodomain (M1-Q970 ...