Labshake search
Citations for GenScript :
601 - 650 of 699 citations for Recombinant Human PRMT5 Flag & His tagged since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Pharmacology and Toxicology 2022Quote: ... The plasmid encoding human CB2 with three amino-terminal HA-tags was custom-synthesized by GenScript (Rijswijk, Netherlands). The plasmids encoding human C5a1 ...
-
bioRxiv - Cell Biology 2023Quote: The full length human arpin sequence cloned into the pET-32a(+) expression vector was from GenScript (Piscataway, NJ). The Arpin-pET-32a(+ ...
-
bioRxiv - Immunology 2023Quote: ... 50 μl of phycoerythrin (PE)– conjugated human angiotensin-converting enzyme 2 (ACE2) (hACE2; 1 μg per milliliter; GenScript) was added to the well and incubated for 30 minutes at 37°C with agitation ...
-
bioRxiv - Cell Biology 2024Quote: ... Peptides encoding residues 166–181 of human CHMP6 or various truncations of HCMV pUL71 were purchased from Genscript at >95% purity and the dry peptides were resuspended in ITC buffer to the desired concentration ...
-
bioRxiv - Biophysics 2024Quote: The full length human KCNQ3 construct (NCBI Reference Sequence: NP_004510.1; GI:4758630) was synthesized (GenScript USA, Piscataway, NJ) and ligated between the BamHI and XbaI sites in the multiple cloning sites of into the pGEM-HE vector ...
-
bioRxiv - Immunology 2024Quote: ... the light chain immunoglobulin variable region sequences were inserted into the human kappa constant region sequence (Genbank accession number OM584289.1) and synthesised into mammalian vector pcDNA3.1 (Genscript). Human J chain was also synthesised into mammalian vector pcDNA3.1 ...
-
bioRxiv - Biochemistry 2024Quote: The APN ectodomain from galline (Genbank ACZ95799.1) and human residues 66-967 was cloned into pcDNA3.1+ plasmid by GenScript with an N-terminal mu-phosphatase signal peptide sequence and C-terminal short linker GGS ...
-
bioRxiv - Immunology 2020Quote: ... synthesized in vitro and subcloned into a pcDNA3.4 vector containing the human IgG1 Fc region by a commercial partner (Genscript). Transfection grade plasmids were purified by maxiprep and transfected into a 293-6E expression system ...
-
bioRxiv - Biochemistry 2019Quote: Synthetic genes encoding human viperin, IRAK1 and TRAF6 (GenBank accession numbers AAL50053.1, NM145803, NM001569 respectively) were purchased from GenScript. For details see supplementary information.
-
bioRxiv - Immunology 2021Quote: ... synthesized in vitro and subcloned into a pcDNA3.4 vector containing the human IgG1 or IgA1 Fc region by a commercial partner (Genscript). Transfection grade plasmids were purified by maxiprep and transfected into a 293-6E expression system ...
-
bioRxiv - Biochemistry 2022Quote: The genes of the human AC isoforms 1 – 9 cloned into the expression plasmid pcDNA3.1+/C-(K)-DYK were purchased from GenScript and contained a C-terminal flag-tag ...
-
bioRxiv - Biochemistry 2022Quote: ... and SARS-CoV-2 Omicron Strain S gene Human codon_pcDNA3.1(+) expressing the spike protein of the Omicron variant (GenScript# MC_0101274) were used as indicated.
-
bioRxiv - Immunology 2020Quote: The construct of human iNOS oxygenase domain (1284 nucleotide) and full length NOSIP (912 nucleotide) were synthesized by GenScript and cloned in pET22b expression vector ...
-
bioRxiv - Biochemistry 2020Quote: ... The DNA fragment encoding human ACE2 (1-615) with a 6xHis tag at C terminus was synthesized by Genscript and cloned to the vector pCMV-IRES-puro ...
-
bioRxiv - Biochemistry 2020Quote: cDNAs encoding the SARS-CoV and SARS-CoV-2 spike proteins were human codon optimized and synthesized by Genscript. cDNA encoding human ACE2 was obtained from MGC clone 47598 ...
-
bioRxiv - Genetics 2022Quote: The pancreatic isoform of human GCK (Ensembl ENST00000403799.8) was codon optimized for yeast expression and cloned into pDONR221 (Genscript). The initial test set GCK variants were generated by Genscript ...
-
bioRxiv - Immunology 2022Quote: ... nanobodies containing human IgG1 Fc in the culture supernatant were captured by AmMag Protein A Magnetic Beads (Genscript L00695) and eluted by Glycine pH 3.0 ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... Blots were first incubated with a rabbit polyclonal antibody against wild-type human POR from Genscript (Genscript, NJ, USA) at a dilution of 1:1000 ...
-
bioRxiv - Synthetic Biology 2021Quote: The human TDF HMG-box (hereinafter called TDF) was cloned into the plasmid pET-24c (+) (KanR) by GenScript (USA) using the sequence from the position 313 to 528 of the mRNA ...
-
bioRxiv - Biochemistry 2021Quote: DNA polynucleotides encoding the opsin domains optimized for human codon usage were synthesized and cloned by GenScript (Piscataway, NJ) into the mammalian expression vector pcDNA3.1 (Life Technologies ...
-
bioRxiv - Immunology 2020Quote: Full-length human codon-optimized SARS-CoV-2 Spike (S) glycoprotein (NC_045512.2) in pUC57 was obtained from GenScript (MC_0101081). The plasmid was used as a PCR template to generate a cDNA encoding SARS-CoV-2 Spike with a deletion in the nucleotides encoding the C-terminal 19 amino acids (S-Δ19CT ...
-
bioRxiv - Microbiology 2021Quote: Western blotting procedures to determine the proteolytic cleavage of the HA were carried out as previously described.24,33 HEK293T cells were co-transfected with pCAGGS expression plasmids encoding for the corresponding HA and pcDNA3.1 plasmids encoding human airway proteases (Genscript). The Western blotting procedure was carried out with cell lysates ...
-
bioRxiv - Molecular Biology 2021Quote: ... Plasmids harboring C-terminally Flag-tagged wild-type or mutant human TDP-43 and p38α sequences in the pcDNA3.1+/C-(K)-DYK mammalian expression vector were purchased from Genscript and PRMT1 plasmid was purchased from Origene ...
-
bioRxiv - Microbiology 2021Quote: The human codon-optimized S gene of SARS-CoV2 (Wuhan-Hu-1 isolate, accession number MN908947.3) was obtained from GenScript. Site-directed mutagenesis was used to produce the glycan-masking S mutant genes ...
-
ORAI1 establishes resistance to SARS-CoV-2 infection by regulating tonic type I interferon signalingbioRxiv - Microbiology 2021Quote: ... sgRNAs targeting human interferon alpha and beta receptor subunit 1 (IFNAR1) subcloned into pLentiCRISPR v2 was purchased from GenScript (catalog # IFNAR1 crRNA 1 ...
-
bioRxiv - Immunology 2020Quote: ... Commercial antibodies tested also included a human IgG chimeric antibody from GenScript (SARS-CoV-2 spike S1 Antibody (HC2001), GenScript #A02038 ...
-
bioRxiv - Microbiology 2022Quote: All constructs were PCR amplified from a codon optimized gene block encoding the coding sequence of human DYRK1A (GenScript) using Q5 High-Fidelity DNA Polymerase with GC enhancer buffer (New England Biolabs) ...
-
bioRxiv - Molecular Biology 2022Quote: IgGFc: Human IgG Fc Sequence (Supplementary Material Figure S1) was codon optimized for HEK293 expression and synthesized from Genscript USA in pUC57 vector ...
-
bioRxiv - Immunology 2022Quote: ... and subcloned into an expression vector containing the human IgG1 or IgA1 Fc region by a commercial partner (Genscript). Transfection grade plasmids were purified by maxiprep and transfected into CHO cells ...
-
bioRxiv - Biochemistry 2023Quote: The DNA sequence of pancreatic human GCK (Ensembl ENST00000403799.8) was codon optimized for yeast and cloned into pDONR221 (Genscript). Selected missense variants were generated by Genscript ...
-
bioRxiv - Microbiology 2023Quote: ... HA sequence was used to construct a human codon-optimized gene which was synthesized and cloned into the BamHI and EcoRI sites of pcDNA3.1+ by GenScript. The SARS-CoV-2 spike gene (Wuhan ...
-
bioRxiv - Immunology 2022Quote: ... fused at the C-terminus to the Fc region of human IgG1 and cloned into pcDNA3.1(+) vector by Genscript.
-
bioRxiv - Bioengineering 2023Quote: The L1 gene fragment sequences of human papillomavirus (HPV) types 16 and 18 were incorporated into the pCDNA3.1(+) plasmid by Genscript. To amplify the specific regions of interest ...
-
bioRxiv - Cell Biology 2023Quote: ... pmCherry-N1-VAMP3 S48E pmCherry-N1-VAMP3 S48A and pEGFP-N1-WDFY2 (human) were generated as synthetic constructs (Genscript).
-
bioRxiv - Immunology 2024Quote: Cognate VH and VL antibody sequences of interest were synthesized and cloned into a customized pcDNA 3.4 vector containing a human IgG1 Fc region by GenScript Biotech ...
-
bioRxiv - Molecular Biology 2023Quote: ... casΦ-2 of Biggiephage (22), a short, non-CIS related AMPs, human ll-37 (Uniprot: P49913, ‘[LL-37, 37 aa]’) afp18ΔC8 from Genscript. The two non-CIS cargos ll-37 and casΦ-2 were cloned into the designed afp18 N-terminal constructs including the first 50 ...
-
bioRxiv - Biophysics 2024Quote: The hKir2.1 cDNA gene coding the sequence of human Kir2.1 was cloned into the mammalian expression vector pMT3 containing an Ampicillin resistance gene (GenScript). Kir2.1 pathological mutants (C154Y ...
-
bioRxiv - Cancer Biology 2021Quote: ... XPA expression plasmids contain full-length human XPA (NM_000380) with the indicated mutations in the pcDNA3.1(+) backbone (GenScript custom order).
-
bioRxiv - Bioengineering 2020Quote: Codon-optimized forms of human ACE2 binding region (amino-acids 19-615) and modified ACE2 genes were chemically synthesized (Genscript), and were subcloned upstream of a human Fc region (derived from IgG1 ...
-
bioRxiv - Biochemistry 2021Quote: ... The H4 substrate peptide used in the assay corresponds to the first 19 residues of human H4 (NH2-SGRGKGGKGLGKGGAKRHR-COOH; GenScript). In the assay ...
-
bioRxiv - Biochemistry 2021Quote: ... sequences with codons optimized for expression in human cells were synthesized and cloned into pHLSec between AgeI/KpnI by Genscript. The constructs were co-transfected with Furin-encoding plasmid ...
-
bioRxiv - Immunology 2021Quote: ... Plates were washed three times with PBS-T (PBS with 0.1% Tween-20) and 50 μl of HRP anti-Human IgG Antibody (GenScript #A00166) diluted 1:5000 in dilution solution were added to each well ...
-
bioRxiv - Microbiology 2021Quote: ... NS3/4A expression vector was generated by subcloning a synthetic gene which was codon optimized for expression in human cells (Genscript) into the pCI plasmid ...
-
bioRxiv - Molecular Biology 2022Quote: ... The coding sequences of human UBXN1 (Uniprot identifier Q04323-1) and FAF2 (Uniprot identifier Q96CS3-1) were synthesized by GenScript Biotech ...
-
bioRxiv - Microbiology 2020Quote: The IgG heavy and light chain variable genes of CB6 mAb (GenBank: MT470196 and MT470197) were human codon-optimized and synthesized by Genscript and cloned into antibody expression vectors.
-
bioRxiv - Systems Biology 2020Quote: Clones were either collected from the human Orfeome 3.1 and 8.1 clone libraries (full length clones) or ordered as synthetic genes from Genscript (RBP constructs). As in our previous work (Jolma et al ...
-
bioRxiv - Microbiology 2021Quote: ... RBD-binding peptide SBP1 derived from human ACE2 α helix 1 (Ac-IEEQAKTFLDKFNHEAEDLFYQS-NH2) was synthesized by GenScript (Nanjing, China).
-
bioRxiv - Bioengineering 2021Quote: ... 843 RUs of SARS-CoV-2 RBD/SD1 fused to human Fc (RBD/SD1-Fc) and 972 RUs of EGFR (Genscript, Piscataway ...
-
bioRxiv - Immunology 2022Quote: ... Bound IgG was detected as the luminescence signal at 425 nm using an HRP-conjugated anti-human IgG (H&L) secondary antibody (Genscript) and SuperSignal ELISA Femto Maximum Sensitivity Substrate (Thermo Fisher Scientific).
-
bioRxiv - Biophysics 2020Quote: ... The plasmid encoding full-length human DAP5 with an N-terminal 6x-histidine tag was purchased from Genscript (Piscataway, NJ). All the proteins were recombinantly expressed in E ...