Labshake search
Citations for GenScript :
201 - 250 of 548 citations for Recombinant Human CD3e Molecule Epsilon CD3 TCR Complex His tagged since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2023Quote: ... Recombinant BRD4 N-terminal protein was purchased from GenScript (BRD4-N (49-460aa), His ...
-
bioRxiv - Synthetic Biology 2023Quote: ... Some recombinants were generated by homologous recombination using GenBuilder Kit (GenScript Biotech Corporation) following manufacturer’s instructions.
-
bioRxiv - Cell Biology 2023Quote: ... The HA-tagged wild-type PITPα/β constructs and PI-binding deficient mutants T59D33 were purchased from Genscript. Constructs were transfected in mammalian cells by the lipid-based delivery system from Invitrogen (LipofectamineTM3000 ...
-
bioRxiv - Immunology 2021Quote: ... Western blot and immunoprecipitation and has sensitivity comparable to the THE™ His Tag Antibody (Genscript) in ELISA and Western Blot (Supplementary Fig.S7).
-
bioRxiv - Biophysics 2021Quote: ... This was followed by several PBS wash steps and incubation with anti-His antibody (#25B6E11, Genscript) at a dilution of 1:500 for 1h in 0.1 % FBS/PBS ...
-
bioRxiv - Molecular Biology 2021Quote: AngII and TRV023 (Sar-Arg-Val-Tyr-Lys-His-Pro-Ala-OH) were synthesized by GenScript USA (Piscataway ...
-
bioRxiv - Microbiology 2023Quote: The full recombinant MPL36 protein (rMPL36/aa 41-321) was commercially produced by GenScript® Biotech with His-tag in an E ...
-
bioRxiv - Microbiology 2021Quote: ... Production of FLAG-tagged transporter proteins was assessed by western blotting using anti-FLAG antibody (Genscript, Piscataway, NJ, USA) as described previously (5).
-
bioRxiv - Biophysics 2022Quote: The C-terminal FLAG-tagged mouse mGluR2 construct in pcDNA3.1(+) expression vector was purchased from GenScript (ORF clone: OMu19627D) and verified by sequencing (ACGT Inc) ...
-
bioRxiv - Cell Biology 2022Quote: ... The synthesis and cloning of this Flag and 6xHis tagged TgSORT coding nucleotide sequence in pPINKαHC were performed by Genscript based on P ...
-
bioRxiv - Microbiology 2023Quote: ... The following plasmids were used in this study: FLAG tagged ORFs in pcDNA3.1+/C-(K)DYK were purchased from Genscript: CDK1 (NM_001786.5) ...
-
bioRxiv - Immunology 2024Quote: ... for expression in HEK293T or tagged with FLAG-HA then cloned into the pUC57-mini vector (synthesized by Genscript) to be used as template for in vitro mRNA transcription ...
-
bioRxiv - Immunology 2021Quote: ... linked by a 6 aa linker and including a C-terminal HIS-tag were prepared by Genscript® (Piscataway ...
-
bioRxiv - Microbiology 2022Quote: ... Omicron BA 1.1 spike (from Dr. Raul Cachau, NIAID) or CoV-2 Spike RBD (His-Tag, Genscript) was diluted in phosphate buffered saline (PBS ...
-
bioRxiv - Immunology 2023Quote: ... The construct CZA97.012 SOSIP.664 with His-tag (GSGSGGSGHHHHHHHH) was cloned into the pPPI4 expression vector (GenScript). HEK-293F cells were transiently transfected by the use of 293fectin (Thermo Fisher Scientific) ...
-
bioRxiv - Cell Biology 2023Quote: The pcDNA3.1-NR2A (catalog #: OHu24642D, NM_000833, human) and the pcDNA3.1-NR1 (catalog #: OHu22255D, NM_007327, human) plasmids were purchased from GenScript. The pcDNA3.1-BiP plasmid was provided by Dr ...
-
bioRxiv - Molecular Biology 2021Quote: ... The purified FLAG-tagged proteins were cleaved from MBP or Glutathione S-transferase (GST) using 3C protease (Genscript #Z03092-100) and their purity was analyzed by SDS-PAGE.
-
bioRxiv - Neuroscience 2022Quote: ... we obtained an expression plasmid containing a C-terminal 3Xflag tagged BioID2 sequence with a 198bp (13X “GGGGS” repeat) linker sequence upstream of BioID2 (Genscript). For lentiviral expression ...
-
bioRxiv - Microbiology 2022Quote: ... a gene SIRT7 (C-terminally 3xFLAG tagged) under the control of a CMV promoter in pcDNA3.1 was commercially synthesized (GenScript, USA). For transfection experiments ...
-
bioRxiv - Neuroscience 2022Quote: ... we obtained an expression construct containing a 198bp (13x “GGGGS” repeat) linker sequence upstream of a C-terminal 3xFLAG-tagged BioID2 sequence with BioID2 (Genscript). For lentiviral expression ...
-
bioRxiv - Biochemistry 2023Quote: The BoNT/X-NTNH/X complex was recombinantly co-expressed from a pET-22b vector encoding His6-tagged R360A/Y363F inactive mutant of BoNT/X and from a pET-28a(+) vector encoding NTNH/X (GenScript). The expression was performed in E ...
-
bioRxiv - Cancer Biology 2023Quote: Doxycycline-inducible gene overexpression vectors for DDX46 and hTATSF1 were prepared by cloning C-terminally HA-tagged DDX46 (Genscript, OHu29752) and hTATSF1 (amplified from K562 cDNA prepared using oligo(dT ...
-
bioRxiv - Bioengineering 2021Quote: ... 2 mM CaCl2) using 10 U of Recombinant Bovine His6-Enterokinase (GenScript, Piscataway, NJ, USA) overnight at room temperature ...
-
bioRxiv - Biochemistry 2022Quote: cDNA constructs for expression of recombinant Mac-1 in mammalian cells were generated by GenScript. ITGAM cDNA was cloned into the vector pcDNA3.1/HygroB(+) ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... custom polyclonal antibodies raised against recombinant fragment antigen generated by immunization of rabbits (GenScript, USA). The sequence of the recombinant fragment was ITGCLSLYDLKLIAAVMSCPVAQRHFETEEDKKDEDEDDRAEDPVDENPDDTITVSQMWQDF LHTLTLHGFRFVFERGPTHHHHHH ...
-
bioRxiv - Microbiology 2023Quote: ... enterica Tsr LBD construct for recombinant protein expression was performed as a service by Genscript Biotech Corp ...
-
bioRxiv - Molecular Biology 2021Quote: ... All purification steps were monitored either by Coomassie-stained SDS-PAGE or anti-HIS western blot (Genscript #A00186). HMT assays were essentially performed as described in (Frapporti et al. ...
-
bioRxiv - Biophysics 2022Quote: ... then synthesized and cloned into the pET26b(+) vector in frame with an C-terminal 6 × His tag (GenScript). BL21 DE3 cells were transformed with the plasmid and grown at 37°C in TB media supplemented with 1 mM MgCl2 ...
-
bioRxiv - Microbiology 2020Quote: ... and then incubated with 45 μL each of 0.1 μg/mL of THE anti-his-HRP (GenScript, A00612) in PBST/BSA for 1 hr at room temperature ...
-
bioRxiv - Cell Biology 2021Quote: Codon optimized human SHIP164 generated by Genscript was amplified using PCR from the pUC57 plasmid and ligated into various mammalian and bacterial expression plasmids ...
-
bioRxiv - Genomics 2021Quote: ... human Hek293 DNA was purchased from Genscript. S ...
-
bioRxiv - Neuroscience 2022Quote: Human Stathmin expression clones were from Genscript (STMN1-OHu14092D ...
-
bioRxiv - Biophysics 2022Quote: Isoform 1 of human SERINC2 (GenScript-OHu23082D) was cloned into pFastBacI with the TEV and STREP cleavage and affinity tags upstream of the gene encoding hSERINC2 ...
-
bioRxiv - Biochemistry 2021Quote: ... FLAG-tagged proteins were released from the resin by incubation with buffer supplemented with 50 mM FLAG peptide (Genscript, Piscataway, NJ) for 30 min.
-
bioRxiv - Molecular Biology 2022Quote: ... N-terminal 6xHis-Flag-tagged SUMO2 was cloned into BamH1 and Xho1 restriction sites of pcDNA5/FRT/TO plasmid by gene synthesis (GenScript Biotech). All primers used for site-directed mutagenesis are listed in supplementary table 1.
-
bioRxiv - Biochemistry 2024Quote: ... 0.04-0.32 picomoles of Tspan12-1D4 and 0.25-2 picomoles of 7xHis-MSP1D1 were probed by Rho anti-1D4 and THE anti-His (GenScript) antibodies respectively ...
-
bioRxiv - Bioengineering 2022Quote: ... The experiments were performed by direct immobilization of the recombinant IL6 protein (Cat. No. Z03034, Genscript), on a CM5 biosensor chip surface (Cytiva ...
-
bioRxiv - Immunology 2022Quote: ... B2 F and hMPV B2F-GCN4 recombinant proteins were synthesized from the plasmids obtained from GenScript cloned into pcDNA3.1+ vector ...
-
bioRxiv - Neuroscience 2024Quote: ... GO grids were first incubated with 3 µL of 250 nM recombinant protein G (Genscript Z02007) in resuspension buffer ...
-
bioRxiv - Developmental Biology 2022Quote: ... residues A27-T157), human FZD7 CRD (UniProt: O75084, residues Q33-G170), human FZD8 CRD (UniProt: Q9H461, residues A28-T158) were synthesized (Genscript). Human LRP6 P1E1P2E2 (UniProt ...
-
bioRxiv - Plant Biology 2021Quote: ... Anti-human IgG peroxidase conjugated (A00166, GenScript, USA) or anti-mouse IgG peroxidase conjugated (A4416 ...
-
bioRxiv - Cancer Biology 2022Quote: ... murine and human CD20 cDNA expression constructs (GenScript) were transiently transfected into 293T cells using lipofectamine (ThermoFisher) ...
-
bioRxiv - Cancer Biology 2022Quote: The H3F3A and H3F3B human cDNA sequences (GenScript) were cloned by using ClaI and EcoRI restriction enzymes into the pSNAPm plasmid (New England Biolabs) ...
-
bioRxiv - Biophysics 2022Quote: The human PEAK3 gene was synthesized by GenScript and subcloned into the pcDNA4/TO vector with a C-terminal 3xFLAG tag ...
-
bioRxiv - Molecular Biology 2022Quote: ... Human SENP1 cDNA (ENST00000448372.5) was synthesised by GenScript to contain an N terminal FLAG tag and synonymous siRNA resistance mutations to the exon 6 and 12 siRNA used (see table 1) ...
-
bioRxiv - Biophysics 2022Quote: The gene that encodes human SERINC3 (Genscript-OHu02717D) was inserted upstream of a thrombin protease cleavable linker (LVPRGS ...
-
bioRxiv - Cell Biology 2023Quote: ... human NAP1 cDNA was gene-synthesized (by Genscript) and subcloned into a pGEX-4T1 vector with an N-terminal MBP-tag followed by a TEV cleavage site before wild-type NAP1 (RRID:Addgene_208871) ...
-
bioRxiv - Biophysics 2020Quote: ... LC3C/B) and the GFP-tagged double mutants (GFP-LC3A-EE, GFP-LC3B-AK) were obtained by subcloning (synthesized by GenScript, Piscataway, NJ).
-
bioRxiv - Biochemistry 2021Quote: Sic1PY and WW-HECT were purified as previously described10. Human UBE1 (plasmid obtained as a gift from C. Tang, Peking University) and human UBCH5A (obtained from GenScript, China) were expressed as GST fusion proteins from pGEX-4T vectors ...
-
bioRxiv - Biochemistry 2022Quote: ... Wells were washed 3 times in PBS and incubated with 1:1000 anti-His HRP antibody (GenScript, A00612, Lot. 19K001984) for 1 hour at room temperature ...