Labshake search
Citations for GenScript :
151 - 200 of 702 citations for Rat Presenilin Enhancer 2 Homolog C. Elegans PSENEN ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2021Quote: ... To monitor V2 responses cyclized C.1086 V2 (cV2, synthesized by GenScript) 157CSFNATTELKDKKHKVHALFYKLDVVPLNGNSSSSGEYRLINC196 was used at 1μg/ml in PBS for coating ...
-
bioRxiv - Biochemistry 2021Quote: ... and pcDNA 3.1+/C-(K)-DYK empty vector were obtained from GenScript Biotech (GenScript ...
-
bioRxiv - Molecular Biology 2020Quote: ... The pCCL-WSB1 and pCCL-c-Myc plasmids were purchased from Genscript, and were re-constructed to pCDH vector with N-terminal FLAG tag ...
-
bioRxiv - Microbiology 2022Quote: ... and pangolin) with a C-terminal V5 tag were synthesized by GenScript as described previously 42 ...
-
bioRxiv - Developmental Biology 2019Quote: ... C-terminally amidated and purified to a purity of >□95% (GenScript, USA), and their antimicrobial activity was estimated in a Minimum Inhibitory Concentration (MIC ...
-
bioRxiv - Microbiology 2024Quote: ... RBP-coding DNA was cloned into a pcDNA3.1-C-HisTag vector (Genscript). For paramyxoviruses ...
-
bioRxiv - Microbiology 2020Quote: ... SARS-CoV-2 pseudoviruses were purchased from GenScript, and neutralization activity was measured using the HEK-293T-ACE2 cell line with the same procedures as mentioned above.
-
bioRxiv - Biophysics 2020Quote: The CoV-2 3CLpro sequence was synthetized (GenScript) for optimized expression in E ...
-
bioRxiv - Immunology 2020Quote: ... using IgE-SARS-CoV-2 spike plasmid (Genscript) and pNL4-3.Luc.R-E-plasmid (NIH AIDS reagent ...
-
bioRxiv - Molecular Biology 2021Quote: ... Purified FMO-2 protein was purchased from GenScript. Purified FMO5 protein ...
-
bioRxiv - Immunology 2021Quote: ... SARS-CoV-2 fusion peptide was synthesized (GenScript).
-
bioRxiv - Immunology 2023Quote: SARS-CoV-2 Spike RBD protein (GenScript #Z03479) was immobilized on high-absorbency 96-well plates at 5 ng/mL and incubated at 4°C overnight ...
-
bioRxiv - Immunology 2024Quote: ... 50 ng/mL of IL-2 (Z02764, GenScript), 10 ng/mL of IL-4 (HY-P70653 ...
-
bioRxiv - Biochemistry 2019Quote: ... cloned into pET11a vector and included a C-terminal His6-tag (GenScript, USA). The AncCP-6An was also designed similarly to the caspase-6 CT (constitutive two-chain ...
-
bioRxiv - Molecular Biology 2022Quote: ... Sepharose beads were then eluted with 0.5 mg/ml c-Myc peptide (Genscript) in TBS ...
-
bioRxiv - Neuroscience 2021Quote: TMEM106B C-terminal fragment (120 – 274) incorporated in pET3A was purchased from Genscript™ ...
-
bioRxiv - Molecular Biology 2020Quote: ... blocked with 5% milk and probed with C-Myc antibody (Genscript A00173-100), Rad53 antibody (Abcam ab104232) ...
-
bioRxiv - Biochemistry 2021Quote: LD membrane protein cDNAs in pcDNA3.1+/C-(k)DYK were purchased from GenScript and their variants with the OPG2 tag ...
-
bioRxiv - Biochemistry 2024Quote: ... hAPN with a C-terminal Flag tag was cloned into pcDNA3.1+ by GenScript. HEK293T cells seeded at 16E6 cells in 100 mm dishes coated with poly-D-Lysine and incubated overnight at 37 °C with 5% CO2 ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... all with a C-terminus FLAG tag epitope (all from Genscript, Piscataway, NJ). Transfections were performed using Lipofectamine 2000 (ThermoFisher Scientific ...
-
bioRxiv - Biophysics 2024Quote: The mPRD2 construct with a C-terminal His-tag was bought from Genscript Inc ...
-
bioRxiv - Immunology 2023Quote: ... a biotinylated rat polyclonal antibody against human Fc was used as a capture antibody and anti-human IgG Fc-HRP (GenScript Cat# A01854-200) as a detection antibody ...
-
bioRxiv - Biochemistry 2020Quote: ... of SARS-CoV-2 and the ectodomain of human angiotensin converting enzyme 2 (ACE2; residue 1-615) were synthesized by GenScript (Piscataway, NJ). The S gene was fused with a C-terminal twin Strep tag [(GGGGS)2WSHPQFEK(GGGGS)2WSHPQFEK)] and cloned into a mammalian cell expression vector pCMV-IRES-puro (Codex BioSolutions ...
-
bioRxiv - Biochemistry 2020Quote: ... of SARS-CoV-2 (D614) and the ectodomain of human angiotensin converting enzyme 2 (ACE2; residue 1-615) were synthesized by GenScript (Piscataway, NJ). The S gene was fused with a C-terminal twin Strep tag [(GGGGS)2WSHPQFEK(GGGGS)2WSHPQFEK)] and cloned into a mammalian cell expression vector pCMV-IRES-puro (Codex BioSolutions ...
-
bioRxiv - Biochemistry 2020Quote: ... faecalis (UniProtKB-Q07448) and with a C-terminal His6-tag were synthesized by GenScript and cloned into the the pET11a vector ...
-
bioRxiv - Bioengineering 2021Quote: ... pcDNA3.1+C-eGFP plasmid and plasmid encoding Cas9 and sgRNA were purchased from GenScript® ...
-
bioRxiv - Molecular Biology 2022Quote: ... Sam68 C-terminal cDNA was synthetized with optimized codon composition for bacterial expression (Genscript).
-
bioRxiv - Developmental Biology 2020Quote: ... Full-length mRNA constructs in pcDNA3.1+/C-(K)DYK vectors were obtained from GenScript Biotech (Piscataway ...
-
bioRxiv - Microbiology 2023Quote: Synthetic peptides of P covering the sequence N-EDDIYQLIM-C were obtained from GenScript. The peptide was dissolved in deionised water dosed with a drop of 5 M NH4OH to improve solubility ...
-
bioRxiv - Microbiology 2023Quote: ... Full-length and C-terminal constructs were purified by Ni-IDA affinity chromatography (GenScript) as per the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2023Quote: ... pcDNA3.1-C-FLAG containing human ATP6V1H transcript variant 1 (NM_015941.4) was purchased commercially (GenScript). pcDNA3.1-ATP6V1H(1-351)-FLAG ...
-
bioRxiv - Immunology 2022Quote: ... 10-residue SARS-CoV-2 S2 peptide FKEELDKYFK (GenScript) was dissolved in 100% DMSO at 10 mg/mL and then diluted with PBS to 1 mg/mL ...
-
bioRxiv - Immunology 2021Quote: ... SARS-CoV-2 Nucleocapsid was purchased from Genscript (Z03480). SARS-CoV-1 spike (40634-V08B) ...
-
bioRxiv - Plant Biology 2021Quote: ... flg22 (2 µM; Genscript, Piscataway, Township, New Jersey, USA). All PAMPs were dissolved in 10 mM MgCl2 ...
-
bioRxiv - Microbiology 2022Quote: ... Following the injection of 2 units PreScission Protease (GenScript), the column was sealed and placed on a rotator at 4 °C ...
-
bioRxiv - Microbiology 2020Quote: The anti-LmrC(2) antibody was generated by GenScript USA Inc ...
-
bioRxiv - Immunology 2021Quote: ... using IgE-SARS-CoV-2 S plasmid variants (Genscript) co-transfected with pNL4-3.Luc.R-E-plasmid (NIH AIDS reagent ...
-
bioRxiv - Immunology 2021Quote: ... using IgE-SARS-CoV-2 S plasmid variants (Genscript) co-transfected with pNL4-3.Luc.R-E-plasmid (NIH AIDS reagent ...
-
bioRxiv - Immunology 2023Quote: ... A SARS-Cov-2 neutralizing monoclonal antibody (GenScript #A02057) was used as a positive control at a starting concentration of 3.2 ng/µL ...
-
bioRxiv - Immunology 2023Quote: The SARS-CoV-2 surrogate virus neutralization test (GenScript) was used to detect neutralizing antibodies targeting the viral spike (S ...
-
bioRxiv - Immunology 2023Quote: ... 2 µg/mL biotin conjugated Env peptides (GenScript, customized) were added to plates and incubated for 1 hour at RT ...
-
bioRxiv - Neuroscience 2024Quote: ... The mCherry WT- dynamin-2 was constructed by GenScript Corporation (Nanjing ...
-
bioRxiv - Cell Biology 2019Quote: ... and C-terminal YFP-tagged EphB1-Y600F (EphB1-Y600F-YFP) were custom prepared by GenScript. DNA sequencing was performed to verify all the expression constructs sequences ...
-
bioRxiv - Biophysics 2020Quote: The GroES mobile loops3 ETKSAGGIVLTGS and GroEL C-tails (GGM)4M were ordered from Genscript. GroES mobile loops and C-tails were dissolved in MQ water and snap frozen using liquid nitrogen ...
-
bioRxiv - Biochemistry 2021Quote: ... The C-terminal TwinStrep-HA tag (sequence TGGGGSGGGASWSHPQFEKGGSGGGSWSH PQFEKGGYPYDVPDYA*) was synthetized and cloned (by Genscript) between the EcoRI and BamHI sites of the pLVX-TetOne-Puro vector (631849 ...
-
bioRxiv - Biochemistry 2021Quote: A peptide corresponding to the C-terminal 28aa of Nbs1 (Nc28) was purchased from Genscript and dissolved in 100mM HEPES pH 7.4 to a concentration of 2mM as measured by 205nm absorbance ...
-
bioRxiv - Immunology 2022Quote: ... was incubated with the substrate of ssDNA (ssBiotin 26nt Me-C Oligo 30 nM, Genscript), in the presence of aKG (115 μM ...
-
bioRxiv - Cell Biology 2022Quote: Tg-FLAG in pcDNA3.1+/C-(K)-DYK plasmid was purchased from Genscript (Clone ID OHu20241). The Tg-FLAG gene was then amplified and assembled with an empty pcDNA5/FRT expression vector using a HiFi DNA assembly kit (New England BioLabs ...
-
bioRxiv - Immunology 2022Quote: ... was incubated with the substrate of ssDNA (ssBiotin 26nt Me-C Oligo 30 nM, Genscript), in the presence of αKG (115 μM ...
-
bioRxiv - Cancer Biology 2022Quote: ... and the pcDNA3.1+-C-(K)-DYK plasmid expressing Flag-EBP was purchased from GenScript (#OHu18817). Primers for site-directed mutagenesis of the EBP gene were designed using the QuikChange Primer Design Program (https://www.agilent.com/store/primerDesignProgram.jsp?_requestid=1072141 ...