Labshake search
Citations for GenScript :
51 - 100 of 722 citations for Rabbit Anti Enterovirus Polyclonal Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2021Quote: ... using primary antibodies specific for MeV F HRC (rabbit polyclonal, Genscript, 503028-1) and 6xHis tag (rabbit polyclonal ...
-
bioRxiv - Microbiology 2021Quote: ... using primary antibodies specific for MeV F HRC (rabbit polyclonal, Genscript, 503028-1) and 6xHis tag (rabbit polyclonal ...
-
bioRxiv - Immunology 2022Quote: ... This recombinant SmCI-1 was used to generate a rabbit anti-Sm-CI-1 polyclonal antibody using the Custom pAb service offered by Genscript.
-
bioRxiv - Neuroscience 2023Quote: ... FOLR1 was immunoprecipitated by overnight incubation of lysates with rabbit anti-Xenopus laevis FOLR1 polyclonal affinity purified antibody raised against the peptide KHQKVDPGPEDDLHC (custom made by GenScript), chemically cross-linked to protein G-agarose beads at 4°C on a mini-rotator ...
-
bioRxiv - Microbiology 2024Quote: ... The EspE antibody (1:5,000 dilution) was a custom rabbit polyclonal antibody against the CGQQATLVSDKKEDD peptide (Genscript).
-
bioRxiv - Microbiology 2021Quote: ... 0.2% Tween-20) for 30 min and probed with CaBcy1 rabbit polyclonal antibody (GenScript) or CaTpk2 rabbit polyclonal antibody (GenScript) ...
-
bioRxiv - Microbiology 2021Quote: ... polyclonal anti-Bma-LAD-2 peptide antibodies were generated by Genscript. Rabbits were immunized with Bma-LAD-2 peptide sequences conjugated to keyhole limpet hemocyanin (KLH) ...
-
bioRxiv - Plant Biology 2020Quote: Custom affinity-purified polyclonal anti-UCC1 antibodies were produced by Genscript, USA and were used as a primary antibody ...
-
bioRxiv - Biochemistry 2019Quote: ... NPC2 bound to LBPA isomers was detected by incubating the Snoopers with rabbit polyclonal anti-c-myc-tag antibody (RRID: AB_914457, GenScript, Piscataway, NJ) at a concentration of 0.5μg/ml in TBS + 3% BSA for one hour at room temperature ...
-
bioRxiv - Biophysics 2019Quote: ... His-tagged Xenopus laevis HAUS8 was used to produce rabbit polyclonal anti-HAUS8 anti-serum (Genscript). Alexa-647 labelled XenC antibody was generated by first dialyzing antibodies in PBS buffer (50mM NaPO4 ...
-
bioRxiv - Microbiology 2023Quote: ... The immunization of rabbits and affinity purification of p239-specific polyclonal antibody from immunized rabbits were conducted by Genscript Co ...
-
bioRxiv - Microbiology 2023Quote: ... was used to amplify signals from anti-FimH polyclonal antibody (custom antibody produced by Genscript). Slides were counterstained using 10 mg/mL bisBenzimide H 33258 dissolved in TBS for 20 minutes in the dark at room temperature then cover slipped ...
-
bioRxiv - Molecular Biology 2019Quote: ... The anti-Apl polyclonal antibody was generated in a rabbit against the KLH-conjugated Apl peptide ASEIAIIKVPAPIVC by Genscript (New Jersey, USA).
-
bioRxiv - Microbiology 2021Quote: Polyclonal Rabbit antibodies against the potential S-Layer protein of A_DKE were generated by GenScript Biotech B ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... custom polyclonal antibodies raised against recombinant fragment antigen generated by immunization of rabbits (GenScript, USA). The sequence of the recombinant fragment was ITGCLSLYDLKLIAAVMSCPVAQRHFETEEDKKDEDEDDRAEDPVDENPDDTITVSQMWQDF LHTLTLHGFRFVFERGPTHHHHHH ...
-
bioRxiv - Neuroscience 2021Quote: ... rabbit polyclonal short XIRP2 antibody (custom generated against the immunizing peptide NSKRQDNDLRKWGD, Genscript, 1:100), mouse monoclonal IgG1 γ-actin antibody (1-24 ...
-
bioRxiv - Molecular Biology 2023Quote: ... and a custom made anti-P2 gpV polyclonal antibody generated by GenScript. The secondary antibodies were both from Abcam ...
-
bioRxiv - Molecular Biology 2023Quote: ... The next morning the buffer was replaced with 10 ml new TBST (2.5% milk) and primary antibody added (polyclonal rabbit antibodies ordered from GenScript). The antibody used for each blot is indicated in the figure ...
-
bioRxiv - Cell Biology 2019Quote: ... Rabbit polyclonal antibodies against PfAlba3 resulting from immunizations of rabbits with the KLH-conjugate peptide IGKRMFTGNEEKNP were obtained from GenScript Corporation [65] ...
-
bioRxiv - Cell Biology 2024Quote: ... occludin and GFP (#A01388, rabbit polyclonal, GenScript). GAPDH (#AB0060 ...
-
bioRxiv - Plant Biology 2021Quote: ... This polyclonal antibody was raised in rabbits against a synthetic peptide (CKTYLGRPWKEYSRT) (Genscript, Piscataway, NJ, USA) that includes the highly conserved amino acid sequence including residue in the catalytic site of PMEs (Markovič and Janeček ...
-
bioRxiv - Microbiology 2023Quote: ... and a rabbit polyclonal antibody against the full-length PRV VP16 that was ordered from Genscript. Anti-cJun and anti-phospho-cJun (Ser63 ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: ... rabbit anti-p65me2 (customized antibody, Genscript, Piscataway, NJ), mouse anti-FLAG M2 (at 1:3,000 dilution ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... or rabbit anti-myc tag antibodies (GenScript; A00172).
-
bioRxiv - Developmental Biology 2022Quote: To generate a custom rabbit polyclonal antiserum (GenScript), a poly-histidine tagged DUXBL fragment (aminoacids 193-350 ...
-
bioRxiv - Cancer Biology 2024Quote: ... rabbit polyclonal β-catenin(A01211-40; Genscript, China), rabbit polyclonal YAP1(A1002 ...
-
bioRxiv - Developmental Biology 2020Quote: ... Sections were incubated with 1 µg/ml of a custom-made MMP13 rabbit polyclonal primary antibody (GenScript, Piscataway ...
-
bioRxiv - Microbiology 2023Quote: ... gH was detected using custom-made polyclonal rabbit antibodies raised against peptides derived from KSHV gH (Genscript).
-
bioRxiv - Neuroscience 2020Quote: Goat polyclonal anti-GAPDH (GenScript), chicken polyclonal anti-MAP2 (EnCor Biotech ...
-
bioRxiv - Biochemistry 2019Quote: ... we designed and purchased an anti-horse-SLN polyclonal antibody from Genscript (pAb GS3379). The immunogen was a 6-residue N-terminal peptide of horse SLN (Q1MEWRRE6C) ...
-
bioRxiv - Immunology 2023Quote: ... A CM5 chip with covalently immobilized anti-Avi polyclonal antibody (GenScript, Cat #: A00674-40) was used for surface capture of His-Avi tag containing RBDs ...
-
bioRxiv - Molecular Biology 2022Quote: ... MonoRabTM HRP Rabbit anti-Camelid VHH antibody (GenScript #A01861) was used to detect vhhGFP fusion proteins ...
-
bioRxiv - Immunology 2023Quote: ... with MonoRab™ Rabbit Anti-Camelid VHH Antibody (GenScript) diluted 1:250 in coating buffer ...
-
bioRxiv - Microbiology 2022Quote: ... Heterologous expression was detected by electroblotting SDS-PAGE Tris-glycine gels onto nitrocellulose membranes and immunostaining with primary rabbit anti-His-tag antibody and secondary goat anti-rabbit IgG phosphatase alkaline conjugated antibody (GenScript, Piscataway, NJ, USA) (Suppl ...
-
bioRxiv - Molecular Biology 2019Quote: ... Pre-cleared chromatin was incubated with 10 μg of anti-Sir3 polyclonal IgG antibody (Genscript) or anti-Rap1 polyclonal IgG antibody (Abcam ...
-
bioRxiv - Microbiology 2021Quote: ... the membrane was incubated with 1:7000 polyclonal anti-Bma-LAD-2 peptide antibodies (Genscript) and 1:1000 rabbit anti-β actin antibodies (Abcam ...
-
bioRxiv - Molecular Biology 2020Quote: ... UhAVR1 was detected using a custom made antirabbit polyclonal antibody (anti-UhAVR1, GenScript USA Inc). The peptide used to make this antibody is described in Table S4 ...
-
bioRxiv - Microbiology 2023Quote: ... Primary antibodies for assay of transfected cells were goat polyclonal anti-HA (1:500, GenScript), and mouse monoclonal anti-FLAG (1:500 ...
-
bioRxiv - Developmental Biology 2020Quote: ... custom made rabbit anti-chick MMP13 antibody (1μg/ml, Genscript), rabbit anti-CXCL14 (0.2 μg/ml ...
-
bioRxiv - Neuroscience 2020Quote: ... Rabbit anti-mouse ZIP14 antibody was custom made by Genscript. Antibodies for GAPDH and actin were obtained from Cell Signalling.
-
bioRxiv - Microbiology 2022Quote: ... Mouse Anti-Rabbit IgG Fr secondary antibody (GenScript, Piscataway, NJ) 1:30,000 was used for assays of these rabbit-derived samples ...
-
Metal transporter SLC39A14/ZIP14 modulates regulation between the gut microbiome and host metabolismbioRxiv - Physiology 2021Quote: ... Rabbit anti-mouse ZIP14 antibody was custom made by Genscript. Antibodies for ZIP4 ...
-
bioRxiv - Microbiology 2020Quote: ... Rabbit anti-PknG antibody was produced and purified by GenScript Biotechnology with the recombinant GST-tagged PknG protein as immunogen (1/10000 for immunoblotting ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... Blots were first incubated with a rabbit polyclonal antibody against wild-type human POR from Genscript (Genscript, NJ, USA) at a dilution of 1:1000 ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... we used custom polyclonal antibodies raised against recombinant fragment antigens generated by rabbits’ immunization (GenScript, Piscataway Township, NJ, USA). Each recombinant fragment was injected into three rabbits ...
-
bioRxiv - Developmental Biology 2021Quote: Polyclonal antibodies were generated by Genscript (https://www.genscript.com/). The epitopes used for each immunization are listed below.
-
bioRxiv - Neuroscience 2019Quote: The polyclonal DIPγ antibody was generated by Genscript in guinea pigs using the following epitope ...
-
bioRxiv - Developmental Biology 2021Quote: ... The polyclonal NvINSM1 antibody was raised by GenScript in rabbit against amino acids 3 – 170 of NvINSM1 expressed in and purified from E.coli ...
-
bioRxiv - Biochemistry 2021Quote: Polyclonal antibodies against PTP7 were generated by Genscript. Briefly ...
-
bioRxiv - Developmental Biology 2023Quote: Polyclonal antibodies were generated by Genscript (https://www.genscript.com/). The protein sequences used for each immunization were as follows ...