Labshake search
Citations for GenScript :
201 - 250 of 341 citations for QuantiChrom β N Acetylglucosaminidase Assay Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2024Quote: ... gene was codon-optimized and cloned into the p423_GAL1 yeast expression vector as an N-terminal Flag (DYKDDDDK) and C-terminal deca-histidine (10X His) tagged fusion protein (GenScript) (Supplementary Fig ...
-
bioRxiv - Cancer Biology 2024Quote: The PEAK1 peptide used for ITC was synthesized to >95% purity with acetylation at the N-terminus and amidation at the C-terminus (Genscript). The peptide sequence was as follows ...
-
bioRxiv - Biophysics 2024Quote: ... A pET28a(+) plasmid containing an open reading frame for human hnRNPA1 with an N-terminal 6xHis tag was synthesized by GenScript. The 6xHis-hnRNPA1 was expressed in E ...
-
bioRxiv - Biochemistry 2021Quote: RBD inhibition assay: HEK-293T cells stably expressing hACE2 (GenScript M00770) were seeded into a 24-well plate at an initial density of 6 x 104 cells per well ...
-
bioRxiv - Biochemistry 2021Quote: ... Plasmids for complementation assays were generated by Genscript (Leiden, The Netherlands) from the previously described pEKEx2-pknGSt template plasmid (2) ...
-
bioRxiv - Cell Biology 2022Quote: ... Mutated versions of genes for Y2H assay were commercially synthesized (Genscript).
-
bioRxiv - Microbiology 2022Quote: All peptides used for the subsequent assays were synthesized by GenScript USA Inc ...
-
bioRxiv - Cell Biology 2020Quote: FLOE1 and derived mutant constructs for expression in human cells were optimized for human expression (Table S3) and generated through custom synthesis and subcloning into the pcDNA3.1+N-eGFP backbone by Genscript (Piscataway, USA).
-
bioRxiv - Cell Biology 2021Quote: PopZ and derived mutant constructs for expression in human cells were generated through custom synthesis and subcloning into the pcDNA3.1+N-eGFP backbone by Genscript (Piscataway, USA). The mCherry-G3BP1 plasmid was a kind gift of Dr ...
-
bioRxiv - Biochemistry 2021Quote: ... The linear peptides DMT1-II550-568 (AQPELYLLNTMDADSLVSR) and palmitoylated CI-MPR2347-2375 with N-terminal di-lysine (KKSNVSYKYSKVNKEEETDENETEWLMEEIQ) were both synthesised by Genscript (USA).
-
bioRxiv - Molecular Biology 2020Quote: ... vector containing DENV2C protein gene sequence with N-terminal His tag and Tobacco Etch Virus (TEV) digestion site was purchased from GenScript (China). Recombinant capsid protein from DENV2 NGC strain was expressed in Escherichia coli BL21 strain ...
-
bioRxiv - Bioengineering 2021Quote: ... DOPE-NHS (dioleoylphosphoethanolamine N-hydroxysuccinimide; COATSOME FE-8181SU5, NOF America, White Plains, NY) was coupled to synthesized THPs (GenScript, Piscataway, NJ) for self-insertion of the THP-lipid nanoprobes into EV membranes as previously reported with slight modifications [17] ...
-
bioRxiv - Biochemistry 2022Quote: The coding sequence of MtDPP was cloned into plasmid pET28a(+)in frame with an N-terminal 6×His tag (GenScript™). BL21 (DE3 ...
-
bioRxiv - Biochemistry 2022Quote: ... coding sequence was synthesised and cloned into a pET28a plasmid with N-terminal His6-tev purification tag (supplied by Genscript Ltd).
-
Development of monoclonal antibody-based blocking ELISA for detecting SARS-CoV-2 exposure in animalsbioRxiv - Microbiology 2023Quote: ... The SARS-CoV-2 full-length N gene of Wuhan-hu-1 isolate (GenBank # NC 045512.2) was synthesized (GenScript, Piscataway, NJ) and cloned in the pET-28a (+ ...
-
bioRxiv - Cell Biology 2022Quote: ... A cysteine is added to the N terminus of each peptide for coupling chemistry and the peptides are synthesized by GenScript (Inc.). The purity of the three peptides are 96.9% ...
-
bioRxiv - Molecular Biology 2023Quote: ... cDNAs coding for NSP8 and NSP7 proteins were codon-optimised and custom-synthesised with an N-terminal 6X-His tag in the pET28a vector (Figure S1, GenScript, USA). The NSP12 ...
-
bioRxiv - Molecular Biology 2023Quote: ... AAP13442.1) with N-terminal His6 tags were made by inserting DNA between NcoI and BamHI sites of pET15b (GenScript, Piscataway, NJ). pET15b-His6-Nsp1(SARS CoV2 ...
-
bioRxiv - Immunology 2023Quote: ... Raw values were normalized to a synthetic standard on each plate (VHH72-Fc by NRC for spike/RBD or an anti-N IgG from Genscript, #A02039). The relative ratios were further converted to BAU/mL using the WHO International Standard 20/136 as a calibrant (33 ...
-
bioRxiv - Biophysics 2023Quote: Peptides were synthesized with C-terminal amidation (to reduce unwanted charge effects at the carboxy terminus) to generate wild-type and variants of the 17 N-terminal residues of CXCL12 (KPVSLSYRCPCRFFESH) (GenScript Biotech), a peptide known to elicit calcium mobilization and Gαi coupling signaling20 ...
-
bioRxiv - Biochemistry 2022Quote: Codon-optimized gene corresponding to 5 to 897 amino acids of KFDV NS5 with an N-terminal Hexa-histidine tag was synthesized (Genscript USA) and sub-cloned into pET-28a (+ ...
-
bioRxiv - Biophysics 2023Quote: ... coli coding for the N-terminal 264 residues of EWS (EWSLCD) and the tyrosine mutants EWSLCD,7YS and EWSLCD,13YS were obtained from GenScript (NJ). Single point mutations were introduced by site directed mutagenesis using the primers listed in Supp ...
-
bioRxiv - Microbiology 2021Quote: ... bacterial gasdermin genes used for in vivo assays were synthesized by Genscript Corp ...
-
bioRxiv - Biochemistry 2021Quote: ... HEK-293T stable transfected with ACE2 (GenScript M00770, 8000 cells per assay), Caco2 cells (40,000 cells per assay) ...
-
bioRxiv - Bioengineering 2023Quote: ... Luciferase activity was analyzed with a Luciferase Assay System (GenScript, Cat: #L00877C). The relative luminous unit (RLU ...
-
bioRxiv - Neuroscience 2022Quote: ... we custom synthesized a codon-bias optimized Drosophila melanogaster β-tubulin85D gene in which S172 and T219 were mutated to either glutamate (E) or alanine (A) (GenScript, Piscataway, NJ). Each synthesized gene was FLAG-tagged at the C-terminus and subcloned into pUAST-attB ...
-
bioRxiv - Microbiology 2020Quote: ... Rabbit antibodies against an N-terminal peptide (IPIKDMEVDVEQIA) and a C-terminal peptide (GIPNEERSVTSQTE) of CgRad53 were raised by Genscript (https://www.genscript.com). To help detect CgRad53 by Western blot ...
-
bioRxiv - Biochemistry 2020Quote: ... expression vector with an N-terminal His6-tag and a TEV protease recognition site for removal of the tag (GenScript; Piscataway, NJ). In addition ...
-
bioRxiv - Immunology 2019Quote: ... B10.RIII mice (female, 6 to 8 weeks old, n = 8) were immunized with 100 μg IRBP160-181 peptide (GenScript, Piscataway, N.J.) dissolved 100 μl PBS emulsified in 100 μl of complete Freund’s adjuvant ...
-
bioRxiv - Biochemistry 2021Quote: ... were each synthesised with a N-terminal honeybee melittin signal peptide and a C-terminal TEV protease cleavage site and His6-tag by GenScript (Hong Kong) and subcloned into the pFastBac1 vector.
-
bioRxiv - Biophysics 2021Quote: ... Human l-Opa1 (isoform 1) and s-Opa1 with Twin-strep-tag at N-terminus and deca-histindine tag at C-terminus (GenScript, NJ, USA) was expressed in Pichia pastoris strain SMD1163 ...
-
bioRxiv - Biochemistry 2022Quote: ... coli codon optimized SpRY and SpRY-HF1 coding sequences including an N-terminal MKIEE tag and C-terminal SV40 NLS and 6x histidine tag were synthesized (GenScript, NJ, USA) and cloned into pET28 expression vectors ...
-
bioRxiv - Molecular Biology 2020Quote: ... HRAS and NRAS gene sequences (residues 1–166, with an N-terminal His-tag and C-terminal BAP-tag were synthesized by GenScript (Piscataway, USA) and cloned into pET11a ...
-
bioRxiv - Biochemistry 2020Quote: ... BiP at 50 μM was incubated for 6 h at 24°C with 1 mM ADP and 1.3 μM fluorescently labelled NR peptide (NRLLLTG carrying a fluorescein moiety at the N-terminus, custom synthesised by GenScript at >95% purity) (Yang et al. ...
-
bioRxiv - Biophysics 2021Quote: ... coli optimized codons for the C0-C2 portion of human cMyBP-C with N-terminal 6x His tag and TEV protease cleavage site were obtained from GenScript (Piscataway, NJ). For TR-FRET binding assays ...
-
bioRxiv - Biochemistry 2021Quote: ... The cDNAs were then cloned into pET-15b such that the expressed proteins would contain an N-terminal His-Tag (GenScript, Piscataway, NJ). Transformation of competent DH5α E ...
-
bioRxiv - Cell Biology 2022Quote: ... flanking the EVT region (intron is between the N and G residues) and the KLH-conjugated antibody was purified by protein G column (GenScript USA Inc.). Samples were mounted in VECTASHIELD (Vector Laboratories ...
-
bioRxiv - Synthetic Biology 2022Quote: DNA chunks comprising ∼5-10 Kb of each megachunk were synthesized and sequence verified by Genscript (megachunks A-K and N-X), GeneArt (megachunks L ...
-
bioRxiv - Immunology 2022Quote: Synthetic peptides containing the N-loop or the C-terminal sequence of human chemokines were designed and obtained (> 75% purity) from GenScript (Hong Kong). All peptides are biotinylated (biotin-Ahx ...
-
bioRxiv - Immunology 2023Quote: Antibody variable heavy and light chain regions were synthesized by gene synthesis with appended N-terminal signal sequences (Genscript Biotech, Piscataway, NJ) and subcloned into IgG1 or lambda or kappa light chain based PCDNA3.1 mammalian expression plasmids ...
-
Targeted Perturb-seq Reveals EGR1 and FOS as Key Regulators of the Transcriptional RAF-MAPK ResponsebioRxiv - Systems Biology 2024Quote: ... sgRNA template sequences of the format: 5′-GGAGAACCACCTTGTTGG-(N)20-GTTTAAGAGCTAAGCTGGAAAC-3′ were synthesized in a pooled format on microarray surfaces (GenScript Biotech, Inc.). Oligo pools were PCR-amplified using Phusion Flash High-Fidelity PCR Master Mix (ThermoFisher Scientific ...
-
bioRxiv - Bioengineering 2023Quote: Genes encoding the Nb24 and mNb6 WT nanobodies and their humanised variants were synthesized and cloned into an isopropyl-β-D-thiogalactopyranoside (IPTG)–inducible vector (by Genscript in vector pET29a(+)) ...
-
bioRxiv - Bioengineering 2022Quote: ... Peptides for zinpyr-1 competition binding assay were synthesized by GenScript (Piscataway, NJ). Reagents for making competent E.coli cells were obtained from Zymo Research (Irvine ...
-
bioRxiv - Biophysics 2019Quote: ... bearing an N-terminal His6-TEV affinity tag and ClpP (Uniprot entry: Q9JZ38) with an N-terminal His6-SUMO tag were synthesized by GenScript (Piscataway, NJ, USA) and cloned into the NdeI and BamHI sites of pET28a+ (Novagen ...
-
bioRxiv - Biochemistry 2022Quote: ... as a C-terminal fusion to an N-terminal small ubiquitin-related modifier (SUMO) tag using BsaI and XhoI (GenScript, Piscataway, NJ, USA). This results in a construct that ...
-
bioRxiv - Cell Biology 2019Quote: ... Phospho-peptides conjugated to biotin for ELISA assay were synthesized by GenScript (Hong Kong). Antibodies against the IR β-subunit (sc-57342 ...
-
bioRxiv - Immunology 2021Quote: ... All Neutralization assays were performed with the surrogate virus neutralization test (sVNT) (GenScript, USA), following the manufacturer’s instructions ...
-
bioRxiv - Immunology 2020Quote: ... Minimal epitopes used in in vitro proliferation assays were ordered from Genscript (≥ 95% pure).
-
bioRxiv - Immunology 2022Quote: ... binding of SARS-CoV2 and control IgG antibodies (at 1 µg/ml) to 15-mer S2 overlapping 5-amino acid peptides (n=52, GenScript Biotech, 500 ng/well) was tested using the same procedure as previously described (Wardemann ...
-
bioRxiv - Immunology 2022Quote: ... The following peptides were used for T cell stimulation in ICS assays: Trp1 (NTPQFENL, GenScript), Trp2 (SVYDFFVWL ...