Labshake search
Citations for GenScript :
1 - 50 of 644 citations for Proteasome 26S Subunit Non ATPase 10 PSMD10 Antibody since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Plant Biology 2024Quote: ... ATPase-deficient version of MtABCG40 (MtABCG40-ATPase - E344Q and E1029Q) was generated by GenScript.
-
bioRxiv - Neuroscience 2023Quote: ... # E7) in 5% non-fat milk TBST and FOLR1 antibody in 5% non-fat milk TBST (GenScript). Anti-GFP antibody or normal rabbit IgG were used as controls in FOLR1-CD2AP co-IP experiments.
-
bioRxiv - Microbiology 2024Quote: ... against HCoV-NL63 S1 subunit and mouse monoclonal Ab (ID: 24C9F7) against HCoV-229E S1 subunit were generated by Genscript. Rabbit polyclonal Ab against SARS-CoV-2 RBD was obtained from Sino Biological (Cat No ...
-
bioRxiv - Cell Biology 2022Quote: ... The primary antibody against Ft-L was made using recombinant human Ft-L subunit as antigen by GenScript (Nanjing, China).
-
bioRxiv - Physiology 2021Quote: ... whereas the β-subunit of VHA was immunodetected using a custom-made polyclonal rabbit antibody (epitope: AREEVPGRRGFPGYC; GenScript, Piscataway, USA). These antibodies have been previously used in the inner ear of the Pacific chub mackerel (Scomber japonicus ...
-
bioRxiv - Cell Biology 2024Quote: cDNA encoding native integrin α and β-subunits from Genscript (gene and accession No ...
-
bioRxiv - Microbiology 2023Quote: ... coli KTE188 (Genbank: ANTE01000038)26 was synthesized by Genscript together with its native promoter and terminator sequences and cloned into plasmid pSG1 35 ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... The mouse ASIC1a subunit was synthesized by GenScript (new Jersey, USA) with SacI and BamHI restriction sites flanking the start and stop codons ...
-
bioRxiv - Physiology 2023Quote: ... VHA was immunodetected using custom-made rabbit polyclonal antibodies against a highly conserved epitope within subunit B (epitope: AREEVPGRRGFPGY; GenScript, Piscataway, USA). Both NKA and VHA antibodies have been validated in the inner ear of splitnose rockfish (24 ...
-
bioRxiv - Molecular Biology 2022Quote: ... Arylphorin subunit alpha-like (Demetra) and hexamerin (Ceres) were produced by Genscript, utilizing the baculovirus expression system in insect cells ...
-
bioRxiv - Immunology 2021Quote: ... and S1 subunit (0.5 µg/mL) (cat n° Z03501, GenScript, Piscataway, NJ, USA) purified recombinant proteins dissolved in carbonate-bicarbonate buffer (pH 9.6 ...
-
bioRxiv - Bioengineering 2023Quote: ... or non-degradable (KKCGGDQGIAGFGCKK, Genscript). The value of thiol group ...
-
bioRxiv - Bioengineering 2024Quote: ... or non-degradable (KKCGGDQGIAGFGCKK, Genscript). HA hydrogels had a total peptide crosslinker concentration of 0.838 mM for H80 ...
-
bioRxiv - Molecular Biology 2024Quote: ... The membrane was blocked (PBS, 5% non-fat milk) and probed with rabbit anti-DYDDDDK primary antibody (GenScript, 1:2,500 ...
-
bioRxiv - Biochemistry 2022Quote: The N-terminal peptides of ParBpSM (residues 1-27) and ParBP1 (residues 1-30) used in the ATPase assays were synthesized by GenScript. The sequence of ParBpSM1-27 and its variant ParBpSM1-27 K10A were NH2-MIVGNLGAQKAKRNDTPISAKKDIMGD-CO2H (≥97 % purity ...
-
bioRxiv - Cell Biology 2022Quote: Three subunits of the human mTORC1 complex (mTOR, Raptor, mLST8) were codon-optimized and synthesized (GenScript). The mTOR gene was cloned into a pCAG vector without a tag ...
-
bioRxiv - Biochemistry 2024Quote: Subunit specific fluorogenic substrates were custom synthesized and purified by HPLC to >95% by GenScript (New Jersey). Substrates contained either an N-terminal acetylation group and a C-terminal amc group ...
-
bioRxiv - Biochemistry 2024Quote: ... corresponding to the cleavage site between p48 and p41 subunits in the polyprotein) were synthesized by GenScript USA Inc ...
-
bioRxiv - Cell Biology 2022Quote: ... ferritin L (Ft-L) made by using purified human ferritin L subunit as antigen by GenScript (Nanjing, China).
-
bioRxiv - Biophysics 2023Quote: ... followed by 10 nM biotinylated antibody (mouse anti-FLAG, GenScript). Chambers were flushed to remove reagents ...
-
ORAI1 establishes resistance to SARS-CoV-2 infection by regulating tonic type I interferon signalingbioRxiv - Microbiology 2021Quote: ... sgRNAs targeting human interferon alpha and beta receptor subunit 1 (IFNAR1) subcloned into pLentiCRISPR v2 was purchased from GenScript (catalog # IFNAR1 crRNA 1 ...
-
bioRxiv - Biochemistry 2021Quote: The codon-optimized sequences for the three subunits of avian influenza A/Goose/Guangdong/1/1996 (H5N1) virus polymerases were synthesized (GenScript) and cloned into pFastBac expression plasmid for polymerase expression and structure determination ...
-
bioRxiv - Cell Biology 2022Quote: Wild type prkar2b subunit of bovine PKA and mutant prkar2b (harbouring mutations that ablate all potential miR-34c seed sites) were synthesized (GenScript) and cloned into pmaxGFP vector (LONZA) ...
-
bioRxiv - Biophysics 2022Quote: ... The non-phosphorylated CCR5 peptide (0P) was obtained from GenScript and contained a biotinylated N-terminus.
-
bioRxiv - Cancer Biology 2024Quote: ... or non-targeting control were obtained from Genscript (Piscataway, NJ). Packaged viral particles were used to infect selected cancer cell lines using polybrene media (at a final concentration of 8 μg/ml) ...
-
bioRxiv - Neuroscience 2022Quote: ... ANS4-GFP and bEnd.3 cells were both treated with 100nM of 43gap 26 peptide (VCYDKSFPISHVR) (Genscript, catalogue # RP20274), every 8 hr for 24 hr ...
-
bioRxiv - Cell Biology 2022Quote: ... was inserted between Lys359 and Met360 in the TM3-TM4 intracellular loop of the β2 subunit by using the GenBuilder cloning kit (GenScript, catalog #: L00701). The construction of fluorescently tagged nAChR subunits were described previously [58 ...
-
bioRxiv - Cell Biology 2023Quote: ... was inserted between Lys359 and Met360 in the TM3-TM4 intracellular loop of the β2 subunit by using the GenBuilder cloning kit (GenScript, catalog #: L00701), as previously described 17 ...
-
bioRxiv - Molecular Biology 2023Quote: ... The next morning the buffer was replaced with 10 ml new TBST (2.5% milk) and primary antibody added (polyclonal rabbit antibodies ordered from GenScript). The antibody used for each blot is indicated in the figure ...
-
Evolution of protease activation and specificity via alpha-2-macroglobulin-mediated covalent capturebioRxiv - Synthetic Biology 2023Quote: Michaelis-Menten kinetics of pre-SplB mutants were measured with the peptide substrate Ac-WELQ-AMC (Ac: acetyl-; AMC: 7-Amino-4-methylcoumarin, stock concentration: 26 mM in DMSO, concentration range: 13-1161 μM, Genscript) at an enzyme concentration of 125 nM to 2.5 μM using a Tecan infinite 200Pro (excitation wavelength 339 nm ...
-
bioRxiv - Molecular Biology 2023Quote: The 6-FAM-labeled and non-labeled RNA oligonucleotides were synthesized chemically by GenScript. The RNA annealing reaction containing 10 mM Tris-HCl (pH 7.4 at 25°C) ...
-
bioRxiv - Synthetic Biology 2024Quote: ... and cloned in the non-replicating integration plasmid backbone pMTV210 by GenScript (Nanjing, China). The plasmid pMTV210 was also constructed by GenScript (Nanjing ...
-
bioRxiv - Immunology 2020Quote: ... The samples were analyzed under non-reducing conditions on a 12 % SDS-PAGE gel (GenScript) using the SilverQuest silver staining kit (Invitrogen) ...
-
bioRxiv - Immunology 2021Quote: ... and non-human private were determined by the virus surrogate neutralization kit (cat # L00847, Genscript, Singapore). The percent of neutralizing virus in sera were determinded according to the manufacturer’s protocol
-
bioRxiv - Biochemistry 2021Quote: ... Blots were washed thrice with TBST for 10 min each and incubated with anti-rabbit HRP-coupled secondary antibody (1:10000, Genscript), Cat ...
-
bioRxiv - Molecular Biology 2023Quote: ... casΦ-2 of Biggiephage (22), a short, non-CIS related AMPs, human ll-37 (Uniprot: P49913, ‘LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES’) afp18ΔC8 from Genscript. The two non-CIS cargos ll-37 and casΦ-2 were cloned into the designed afp18 N-terminal constructs including the first 50 ...
-
bioRxiv - Molecular Biology 2020Quote: Commercial synthetic Ste18Nt peptides were synthesized with N-terminal acetylation and C-terminal amidation and various combinations of S3 and S7 phosphorylation (or non-phosphorylated) and enriched to 95% purity (Genscript). Lyophilized peptides were reconstituted in deionized water at a concentration of 2.5 mg/ml and further diluted as necessary with 10mM potassium phosphate buffer (pH 7) ...
-
bioRxiv - Microbiology 2024Quote: ... including about four sgRNAs per gene and 1000 non-targeting control sgRNAs) was synthesized as 79 bp long oligos (CustomArray, Genscript). The oligo pool was double-stranded by PCR to include an A-U flip in the tracrRNA 72 ...
-
bioRxiv - Neuroscience 2020Quote: ... In white clear bottom 96-well plates 10 μL IL-34 antibody (mouse monoclonal IgG2A (v1.1 manufactured by Genscript, Ma et al., 2012), rat monoclonal IgG2A (MAB5195 ...
-
bioRxiv - Biophysics 2024Quote: Samples were quenched using 4X non-reducing Laemmli SDS sample buffer (TPpro, Taiwan) and then separated on 4-20% gradient SDS gels (GenScript, USA). Visualization of protein bands was carried out using an iBright FL1000 system (ThermoFisher ...
-
bioRxiv - Immunology 2021Quote: The cDNA of membrane glyco-protein (MGP) and Non-structure protein 13 (NSP13) of ORF1b from SARS-CoV-2 were purchased from Genscript (NJ, USA) and cloned into lentiviral vector pLVX (TAKARA ...
-
bioRxiv - Immunology 2021Quote: The cDNA of membrane glyco-protein (MGP) and Non-structure protein 13 (NSP13) of ORF1b from SARS-CoV-2 were purchased from Genscript (NJ, USA) and cloned into lentiviral vector pLVX (TAKARA ...
-
bioRxiv - Immunology 2021Quote: Purified RBD was loaded at 0.2 µg/well and electrophoretically separated by SDS-PAGE under non-reducing conditions and transferred to nitrocellulose membranes using an e-blot device (GenScript Laboratories, USA). The membranes were blocked with 5% (w/v ...
-
bioRxiv - Immunology 2024Quote: ... 1% non-essential amino acids and were treated with macrophage colony-stimulating factor (m-MCSF, GenScript, Cat # Z02930-50, 40 ng/ml) for 6-7 days with media change every three days to differentiate bone marrow cells into mouse bone marrow-derived macrophages (BMDMs).
-
bioRxiv - Cell Biology 2024Quote: Biotinylated peptides representing the PRM-containing HER2 tail sequence (GGGGAAPQPHPPPAFSPAFDNL) and the non-PRM IGF1R (GGGGRKNERALPLPQSST) tail sequence were synthesised by Genscript (NJ, USA). Each was then bound to 5µl Cy3-streptavidin (Fluorolink™ ...
-
bioRxiv - Cancer Biology 2024Quote: The sgRNA (small-guide RNA) for knocking out BMAL2 as well as a non-targeting (NT) sequence were purchased from GenScript (Piscataway, NJ) using the pLentiGuide-Puro vector as a backbone ...
-
bioRxiv - Microbiology 2022Quote: ... or mouse anti-FLAG antibody (anti-DYKDDDDK antibody, Genscript) with Pierce ECL Western Blotting Substrate (Thermo Fisher Scientific).
-
bioRxiv - Cancer Biology 2022Quote: ... or mouse (GenScript Z02767-10) IL-6 or w/o.
-
bioRxiv - Zoology 2020Quote: ... 10 wells (Genscript, Nanjing, China). Gels were stained with Coomassie brilliant blue using eStainTM L1 (Genscript).
-
bioRxiv - Biophysics 2021Quote: ... and 10 μM vasopressin (GenScript) for 1.5 h at room temperature (RT) ...