Labshake search
Citations for GenScript :
451 - 500 of 846 citations for Importin subunit alpha 1 KPNA2 Human His since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2021Quote: ... CSP-1 (GenScript, New Jersey, USA), as previously described (36) ...
-
bioRxiv - Cell Biology 2022Quote: ... or GST (1:500, Genscript A00865), followed by 1:3000 HRP-conjugated Goat anti-rabbit or Goat anti-mouse secondary antibodies (Bio Rad) ...
-
bioRxiv - Immunology 2022Quote: ... and 1 μM TPI peptide (Genscript).
-
bioRxiv - Biophysics 2022Quote: ... and 1 μM TPI peptide (Genscript) for surface expression of TPI:HLA-DR1 ligand for the E8 TCR.35
-
bioRxiv - Developmental Biology 2022Quote: ... DUXBL (1:500, custom antibody, GenScript), HDAC1 (1:100 ...
-
bioRxiv - Synthetic Biology 2023Quote: ... and 1 µM ɑ-factor (GenScript), DIX60 (Mam2 ...
-
bioRxiv - Molecular Biology 2023Quote: ... FLAG (1:1,000 (A00187, GenScript, RRID:AB_1720813)) ...
-
bioRxiv - Biophysics 2022Quote: ... Protein was eluted by incubation with 3 BVs elution buffer (wash buffer supplemented with either 3C protease (1:10 w:w 3C:ABCA7) or 0.5 mg ml-1 1D4 peptide (GenScript)) for 2-18 hours.
-
bioRxiv - Cell Biology 2020Quote: ... 10% glycerol) with protease inhibitors and NEM containing 30 μL 1:1 anti FLAG Affinity Gel (Genscript). S100 supernatant was added directly to 600 μL of basic lysis buffer with protease inhibitors and NEM containing 30 μL 1:1 anti FLAG Affinity Gel (Genscript) ...
-
bioRxiv - Biochemistry 2021Quote: ... a SARS-CoV-2 S gene encoding residues 1-1138 (WuhanHu-1; GenBank: MN908947.3) was ordered (Genscript) and cloned into a pPPI4 plasmid containing a T4 trimerization domain followed by a hexahistidine tag by PstI-BamHI digestion and ligation ...
-
bioRxiv - Developmental Biology 2019Quote: Variant #1: a FseI-HH-gRN(#2)NA#1-HDV-HindIII fragment was de novo synthetized (Genscript). This contains a conditional gRNA#1 activatable by the gRNA#2 and flanked by the Hammerhead and HDV ribozymes (29) ...
-
bioRxiv - Biochemistry 2024Quote: ... Clarified lysate from 1 L of culture was incubated with 1 mL of equilibrated Ni-resin (Genscript) and washed with 30 mL wash buffer (50 mM Tris pH 7.5 ...
-
bioRxiv - Developmental Biology 2019Quote: The 5′-regulatory region of human VEGFC gene (NG_034216.1) encompassing 2274 nucleotides (−1 to −2274 in relation to ATG, Figure 1) was synthesized by GenScript. This fragment was then used as a template for deletion of either the proximal (nt −623 to −603 ...
-
bioRxiv - Cancer Biology 2023Quote: ... 1% penicillin-streptomycin) supplemented with 50 mM 2-mercaptoethanol and 1 μg/ml OVA257-264 (SIINFEKL) peptide (GenScript) at at 37 °C and 5% CO2 for 3 days ...
-
bioRxiv - Bioengineering 2023Quote: ... The synthetic peptides AM1 (theoretical Mw = 2472 g·mol-1) and SurSi (theoretical Mw = 3632 g·mol-1) were designed in our lab and synthesized by GenScript® (Nanjing ...
-
bioRxiv - Neuroscience 2021Quote: ... 1 μM CabTRP Ia (GenScript, Piscataway, NJ) was added to the saline ...
-
bioRxiv - Molecular Biology 2020Quote: ... rabbit anti-V5 (GenScript, 1:500 dilution), rabbit anti-HA (Cell Signaling ...
-
bioRxiv - Biochemistry 2020Quote: 2 µg GST (GenScript; Cat. # Z02039-1), ubiquitin (R&D Systems ...
-
bioRxiv - Developmental Biology 2020Quote: ... rabbit anti-Blimp1 (1:1000, GenScript, A01647). Retinas were washed PBS ...
-
bioRxiv - Biochemistry 2021Quote: ... The cDNAs of GALNTs 1-20 (Genscript) were amplified by PCR and digested by BamHI and NotI (GALNT1 ...
-
Recruitment of MRE-11 to complex DNA damage is modulated by meiosis-specific chromosome organizationbioRxiv - Genetics 2020Quote: ... rabbit anti-OLLAS (1:1,000; Genscript #A01658), goat anti-SYP-1 (1:500) ...
-
bioRxiv - Developmental Biology 2020Quote: ... rabbit polyclonal anti OLLAS (Genscript, 1:1500), rabbit polyclonal anti PAR (Trevigen ...
-
bioRxiv - Microbiology 2020Quote: ... 1:250 (GenScript, catalog no. A01658-40), mouse anti-HA 1:500 (BioLegend ...
-
bioRxiv - Microbiology 2021Quote: ... and anti-RFP (1:3000 dilution, GenScript), anti-Dpm1 (1:3,000 dilution ...
-
bioRxiv - Biochemistry 2022Quote: ... and goat anti-Sch9 (GenScript, 1:1’000). To assess the loading ...
-
bioRxiv - Developmental Biology 2022Quote: ... rabbit anti-OLLAS 1:1000 (Genscript, A01658)) were added and incubated overnight in a humid chamber with a parafilm cover ...
-
bioRxiv - Molecular Biology 2023Quote: ... and 10 μM ET-1/ IRL1620 (GenScript) for 1.5 h at room temperature (RT) ...
-
bioRxiv - Immunology 2022Quote: ... or rabbit (GenScript, A00098, 1:2,000 diluted) IgG was added and then developed with 3,3’,5,5’ -tetramethylbenzidine (TMB ...
-
bioRxiv - Microbiology 2023Quote: ... rabbit polyclonal anti-BiP (1:600, GenScript) serum ...
-
bioRxiv - Neuroscience 2023Quote: ... which was bought from GenScript (Table 1).
-
bioRxiv - Neuroscience 2023Quote: ... Tat-beclin 1 (YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT) (7.5 µg, Genscript) or tat-scrambled (YGRKKRRQRRRGGVGNDFFINHETTGFATEW ...
-
bioRxiv - Immunology 2023Quote: ... Streptavidin-HRP (GenScript, M00091; 1:5000 dilution) was added to the wells and incubated at 37°C for 1hr ...
-
bioRxiv - Plant Biology 2024Quote: ... 1 unit of Taq DNA polymerase (GenScript). PCR was conducted at 94 °C for 3 min for denaturation followed by 35-40 cycles of 94 °C for 30 sec ...
-
bioRxiv - Molecular Biology 2023Quote: ... and Anti-LmGAPDH (dilution 1:2,000 - GenScript), followed by incubation with Anti-rabbit IgG (dilution 1:50,000 - BioRad ...
-
bioRxiv - Biochemistry 2024Quote: ... 1 mg/mL 3X-FLAG peptide (Genscript). Final purification was achieved by size exclusion chromatography (SEC ...
-
bioRxiv - Cell Biology 2024Quote: ... rabbit anti-pS1133WRN (Genscript-custom, 1:10000); rabbit anti-GST (Calbiochem ...
-
bioRxiv - Genetics 2023Quote: ... mutans cultures were diluted 1:40 from overnight cultures and grown to an optical density of OD600 ∼0.1 in THYE before the addition of transforming DNA and 1 μg ml−1 Competence Stimulating Peptide (CSP; GenScript). The cultures were subsequently incubated for an additional 2 h and then plated on antibiotic-supplemented THYE plates ...
-
bioRxiv - Molecular Biology 2024Quote: ... mouse anti-Strep-tag (IBA, 2-1507-001, 1:1,000) rabbit anti-CBP-tag (GenScript, A00635-40, 1:1,000), mouse anti-V5-tag (Proteintech Group ...
-
bioRxiv - Cell Biology 2020Quote: ... S100 supernatant was added directly to 600 μL of basic lysis buffer with protease inhibitors and NEM containing 30 μL 1:1 anti FLAG Affinity Gel (Genscript). All samples were incubated overnight at 4°C ...
-
bioRxiv - Biochemistry 2022Quote: The N-terminal peptides of ParBpSM (residues 1-27) and ParBP1 (residues 1-30) used in the ATPase assays were synthesized by GenScript. The sequence of ParBpSM1-27 and its variant ParBpSM1-27 K10A were NH2-MIVGNLGAQKAKRNDTPISAKKDIMGD-CO2H (≥97 % purity ...
-
bioRxiv - Immunology 2022Quote: ... et al (HPV16 E7) and Drakes et al (NY-ESO-1, 1G4 and MART-1, DMF5) were ordered from GenScript in the MSGV-retroviral vector (33 ...
-
bioRxiv - Immunology 2020Quote: The SARS-CoV-2 pseudovirus was produced by co-transfection of HEK293T cells with 1:1 ratio of DNA plasmid encoding SARS-CoV-2 S protein (GenScript) and backbone plasmid pNL4-3.Luc.R-E-(NIH AIDS Reagent ...
-
bioRxiv - Molecular Biology 2022Quote: ... The genes for the designed HN protein variant 1 (HNv1) and F protein variant 1 (Fv1) were codon-optimized for expression in SJ and synthesized by Genscript® ...
-
bioRxiv - Developmental Biology 2022Quote: ... The blot was incubated with 10 μg/mL pre-biotin-CpOGACD for 1 h at room temperature followed by incubation with streptavidin-HRP (1:5000, M00091, GenScript) for 30 min.
-
bioRxiv - Immunology 2023Quote: ... DNA encoding HLA-C*05:01 (1-278) and β2M (1-99) were synthesized and cloned into pET30a by Genscript and were previously described42 ...
-
bioRxiv - Immunology 2023Quote: Genes coding for SARS-CoV-2 Spike (S) ectodomains (Hu-1 and BA.1) with Hisx8 and Strep tags were synthesized by Genscript and cloned into the pcDNA3.1(+ ...
-
bioRxiv - Biophysics 2023Quote: The C-terminal 10mer peptides of nectin-1 and JAM-A (sequences in Supplementary Table 1) were purchased lyophilized from Genscript with N-terminal biotinylation and N-terminal FITC conjugation ...
-
bioRxiv - Molecular Biology 2024Quote: ... or LV1-eGFP-miR-7 were generated by subcloning inserts from pAAV_hSYN1-eGFP-miR-7 and pAAV_hSYN1-eGFP (provided by Thomas B. Hansen) inside LV1 (immunodeficiency virus 1 (HIV-1)-based LV-PGK-GFP) backbone by GenScript Biotech Corporation ...
-
bioRxiv - Developmental Biology 2021Quote: ... and guinea pig anti-Runt (1:600; GenScript). Rhodamine-phalloidin (Invitrogen R415 ...
-
bioRxiv - Developmental Biology 2021Quote: Anti-ApoB-1 antibodies were generated by GenScript USA (Piscataway ...