Labshake search
Citations for GenScript :
1 - 50 of 73 citations for H Leu arg pro gly nh2 2hcl since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2023Quote: ... coupled to a Gly-Gly-Gly-Cys peptide (Genscript). The next morning ...
-
bioRxiv - Biophysics 2023Quote: A Gly-Gly-Gly-Cys peptide with C-terminal amidation (Genscript) was dissolved at 173 mM in degassed coupling buffer (50 mM HEPES (pH 7.4) ...
-
bioRxiv - Biochemistry 2024Quote: The peptidase activity of the 20S CP was measured using a pair of substrates: the tripeptide benzyloxycarbonyl-Val-Leu-Arg-7-amino-4-methylcoumarin (Z-VLR-AMC, Genscript) and a 11-residue oligopeptide conjugated to 7-methoxycoumarin-4-acetic acid referred to as LF211 (7-methoxycoumarin4-acetic acid (MCA)-Lys-Lys-Val-Ala-Pro-Tyr-Pro-Met-Glu-(dinitrophenyl)diaminopropionyl-NH2 ...
-
bioRxiv - Molecular Biology 2021Quote: AngII and TRV023 (Sar-Arg-Val-Tyr-Lys-His-Pro-Ala-OH) were synthesized by GenScript USA (Piscataway ...
-
bioRxiv - Biochemistry 2021Quote: The tetramethylrhodamine (TMR) labeled peptide with sequence Gly-Gly-GLy-Ser-{Lys-(TMR)}was purchased from Genscript. Its mass ...
-
bioRxiv - Neuroscience 2024Quote: ... MTFL457 (Ac-YGRKKRRQRRRHSKFGMKGPASVIS-NH2) or MTFL457AAA (Ac-YGRKKRRQRRRHSAAAMKGPASVIS-NH2) (>95% purity; GenScript) were retro-orbitally injected 10 min after damage initiation ...
-
bioRxiv - Cancer Biology 2022Quote: ... SLIGRL-NH2 (PAR2) and AYPGKF-NH2 (PAR4) (≥95% purity by HPLC) were synthesized by GenScript. PAR1 selective antagonist vorapaxar was purchased from Adooq Bioscience ...
-
bioRxiv - Bioengineering 2023Quote: ... K-peptide (Ac-FKGGERCG-NH2, GenScript), Q-peptide (Ac-NQEQVSPLGGERCG-NH2 ...
-
bioRxiv - Bioengineering 2023Quote: ... Q-peptide (Ac-NQEQVSPLGGERCG-NH2, GenScript), and RGD (Ac-RGDSPGERCG-NH2 ...
-
A balance between pro-inflammatory and pro-reparative macrophages is observed in regenerative D-MAPSbioRxiv - Bioengineering 2023Quote: ... and RGD (Ac-RGDSPGERCG-NH2, GenScript) for at least one hour at 37°C ...
-
bioRxiv - Bioengineering 2023Quote: ... K-peptide (Ac-FKGGERCG-NH2, GenScript), Q-peptide (Ac-NQEQVSPLGGERCG-NH2 ...
-
bioRxiv - Bioengineering 2023Quote: ... Q-peptide (Ac-NQEQVSPLGGERCG-NH2, GenScript) and RGD (Ac-RGDSPGERCG-NH2 ...
-
bioRxiv - Bioengineering 2023Quote: ... and RGD (Ac-RGDSPGERCG-NH2, GenScript) in 0.3 M triethylamine (Sigma ...
-
bioRxiv - Bioengineering 2023Quote: ... and RGD (Ac-RGDSPGERCG-NH2, GenScript) in 0.3 m triethylamine (Sigma ...
-
bioRxiv - Cancer Biology 2023Quote: ... the PEG was functionalized by incubating the 10 kDa 8arm PEG vinyl sulfone (JemKem Technology) with Ac-FKGG-GDQGIAGF-ERCG-NH2 (TG-NDG-Lys) or H-NQEQVSPL-ERCGNH2 (TG-Gln) peptides (GenScript) in triethanolamine (0.3 M ...
-
bioRxiv - Biophysics 2020Quote: ... 10 nM NS2B-NS3pro was incubated with the substrate benzoyl-Nle-Lys-Arg-Arg-7-amino-4-methylcoumarin (Bz-nKRR-AMC) (Genscript) at concentrations varying from 2 to 200 µM ...
-
A balance between pro-inflammatory and pro-reparative macrophages is observed in regenerative D-MAPSbioRxiv - Bioengineering 2023Quote: ... and Q-peptide (Ac-NQEQVSPLGGERCG-NH2, GenScript) and RGD (Ac-RGDSPGERCG-NH2 ...
-
bioRxiv - Bioengineering 2020Quote: ... and 1 mM RGD (Ac-RGDSPGERCG-NH2) (GenScript). The other solution contained an 8mM di-cysteine modified Matrix Metalloprotease (MMP ...
-
Exploring the Role of Spatial Confinement in Immune Cell Recruitment and Regeneration of Skin WoundsbioRxiv - Bioengineering 2023Quote: ... with 500 µM RGD (Ac-RGDSPGERCG-NH2, GenScript), 500 µM K-peptide (Ac-FKGGERCG-NH2 ...
-
Exploring the Role of Spatial Confinement in Immune Cell Recruitment and Regeneration of Skin WoundsbioRxiv - Bioengineering 2023Quote: ... 500 µM K-peptide (Ac-FKGGERCG-NH2, GenScript) and 500 µM Q-peptide (Ac-NQEQVSPLGGERCG-NH2 ...
-
bioRxiv - Biochemistry 2024Quote: ... and γ-glu-ser-gly were custom synthesized from GenScript.
-
bioRxiv - Bioengineering 2021Quote: ... and 5 mM RGD peptide (Ac-RGDSPGERCG-NH2, Genscript) in PBS at a rates of 0.5 - 5 µL/min ...
-
Exploring the Role of Spatial Confinement in Immune Cell Recruitment and Regeneration of Skin WoundsbioRxiv - Bioengineering 2023Quote: ... and 500 µM Q-peptide (Ac-NQEQVSPLGGERCG-NH2, GenScript) and crosslinked at a 0.6 VS to thiol ratio with di-thiol matrix metalloproteinase sensitive peptide (GenScript ...
-
bioRxiv - Bioengineering 2020Quote: ... pre-functionalized with 500μM K-peptide (Ac-FKGGERCG-NH2) (GenScript), 500 μM Q-peptide (AcNQEQVSPLGGERCG-NH2) ...
-
bioRxiv - Molecular Biology 2024Quote: Synthetic Aβ40 (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-NH2) was purchased from GenScript (Rijswijk, Netherlands). Stock solutions were prepared by dissolving 1 mg of the peptide to a final concentration of 250 μM and adding 20 mM sodium phosphate buffer ...
-
A balance between pro-inflammatory and pro-reparative macrophages is observed in regenerative D-MAPSbioRxiv - Bioengineering 2023Quote: ... pH 8.8 and pre-reacted with K-peptide (Ac-FKGGERCG-NH2, GenScript) and Q-peptide (Ac-NQEQVSPLGGERCG-NH2 ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... SLIGRL-NH2 (> 95% purity by HPLC/MS) was purchased from Genscript (Piscataway, NJ) or EZBiolabs (Carmel ...
-
bioRxiv - Bioengineering 2021Quote: ... and 14.1mg/mL di-cysteine modified Matrix Metallo-protease (MMP) (Ac-GCRDGPQGIWGQDDRCG-NH2) (Genscript) peptide substrate were used to form MMP-degradable PicoShells.
-
bioRxiv - Neuroscience 2021Quote: ... melanogaster Crz (pQTFQYSRGWTN-NH2) was custom synthesized at >95% purity by Genscript (Piscataway, NJ, USA); a non-amidated adipokinetic hormone/corazonin-related peptide (naACP ...
-
bioRxiv - Bioengineering 2023Quote: ... The crosslinker solution was prepared by dissolving the MMP-cleavable peptide (Ac-GCRDGPQGIWGQDRCG-NH2, GenScript) in distilled water at 12 mm and 10 μm Alexa-Fluor 647-maleimide (Invitrogen) ...
-
bioRxiv - Bioengineering 2020Quote: ... The other solution contained an 8mM di-cysteine modified Matrix Metalloprotease (MMP) (Ac-GCRDGPQGIWGQDRCG-NH2) (GenScript) substrate with either all L-chirality amino acid residues for L-MMP microgels or D-chirality amino acid substitution of amino acids at the site of MMP-mediated recognition and cleavage (Ac-GCRDGPQDGIDWDGQDRCG-NH2 ...
-
bioRxiv - Bioengineering 2024Quote: ... Dicysteine peptide Ac-GCRDLPESGGPQGIWGQDRCG-NH2 (4S9 degradable sequence, MMP-degradable sequence) was purchased from Genscript (Piscataway, NJ), resuspended in 10% glacial acetic acid ...
-
bioRxiv - Microbiology 2024Quote: ... AA 1-154) of Aquifex aeolicus were fused by a Gly-Ser linker and constructed in a pUC57 plasmid by GenScript USA ...
-
bioRxiv - Biophysics 2020Quote: The C-terminal sequence of the envelope protein (residues 41–75, [NH2]-AYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV-[COOH]) was obtained from Genscript USA Inc. ...
-
bioRxiv - Biochemistry 2022Quote: ... 0.2mg/ml BSA with either fixed or varying concentrations of either the peptide substrate (Biotin-GGGENWYNTLKRKK-NH2) (Genscript) or ATP spiked with 0.8μCi [γ 32P]-ATP (Perkin Elmer) ...
-
bioRxiv - Bioengineering 2023Quote: ... μgels formulated using HA-NB (3.4 wt% (w/v)) precursor solution in 0.3 M HEPES buffer with 3.5 mM MMP-cleavable crosslinker (Ac-GCRDGPQGIWGQDRCG-NH2, GenScript), 1.75 mM Tris(2-carboxyethyl)phosphine hydrochloride (TCEP ...
-
bioRxiv - Biophysics 2024Quote: DNA constructs encoding Aha TRAP-(linker)-TRAP-(TEV cleavage site)-His6 with varying length Gly/Ser linkers were obtained commercially (GenScript, Inc) in a pET21a (Novagen ...
-
A balance between pro-inflammatory and pro-reparative macrophages is observed in regenerative D-MAPSbioRxiv - Bioengineering 2023Quote: ... the cross-linker solution was prepared by dissolving the di-thiol matrix metalloproteinase sensitive peptide (Ac-GCRDGPQGIWGQDRCG-NH2, GenScript) in distilled water at 12 mM and reacted with 10 μM Alexa-Fluor 647-maleimide (Invitrogen ...
-
bioRxiv - Bioengineering 2023Quote: ... The cross-linker solution was prepared by dissolving the di-thiol matrix metalloproteinase-sensitive peptide (Ac-GCRDGPQGIWGQDRCG-NH2, GenScript) GenScript ...
-
bioRxiv - Biochemistry 2021Quote: ... to reflect the reducing conditions in the cytoplasm of the cell) and AQP4ct (Ac-256VEFKRRFKEAFSKAAQQTKG SYMEV280-NH2) peptides were synthesized by Genscript Inc ...
-
bioRxiv - Biochemistry 2021Quote: ... The H4 substrate peptide used in the assay corresponds to the first 19 residues of human H4 (NH2-SGRGKGGKGLGKGGAKRHR-COOH; GenScript). In the assay ...
-
bioRxiv - Biochemistry 2021Quote: ... 100 nM of hNatA was mixed with 30 μM of [14C]acetyl-CoA and 30 μM of either H4 peptide or SASE peptide (NH2-SASEAGVRWGRPVGRRRRP-COOH; GenScript), with none ...
-
bioRxiv - Biochemistry 2021Quote: 300 nM of hNatE was mixed with 50 μM [14C]acetyl-CoA and 100 μM of MLGP peptide (NH2-MLGPEGGRWGRPVGRRRRP-COOH, GenScript), with none ...
-
bioRxiv - Biochemistry 2021Quote: 50 nM of SpNatC was mixed with 30 μM [14C]acetyl-CoA and 10 μM of MLRF peptide (NH2-ML RFVTKRWGRPVGRRRRPCOOH, GenScript), with none ...
-
bioRxiv - Biochemistry 2021Quote: 100 nM of hNatB was mixed with 50 μM [14C]acetyl-CoA and 50 μM of MDVF peptide (NH2-MDVFMKGRWGRPVGRRRRP-COOH, GenScript), with none ...
-
bioRxiv - Microbiology 2021Quote: ... RBD-binding peptide SBP1 derived from human ACE2 α helix 1 (Ac-IEEQAKTFLDKFNHEAEDLFYQS-NH2) was synthesized by GenScript (Nanjing, China).
-
bioRxiv - Pharmacology and Toxicology 2021Quote: Mpro inhibition assay was performed using the FRET-based fluorescent peptide substrate DABCYL-KTSAVLQ↓SGFRKM-E(EDANS)-NH2 (purchased from Genscript). The assay was standardized with enzyme concentration of 140 nM and 30 µM of fluorescent substrate in Mpro assay buffer containing (20 mM Tris pH 7.3 ...
-
bioRxiv - Biochemistry 2020Quote: Immunogen peptide S2 (ACNH-CGAGT(AMP)GAG-NH2) was conjugated with KLH and BSA as immunogen via its N-terminal cysteine (GenScript).
-
bioRxiv - Bioengineering 2023Quote: ... the aqueous phase consisted of 10 kDa 8-arm PEG-vinyl sulfone (PEG-VS) (JenKem, Plano, TX) and RGD (Ac-RGDSPGERCG-NH2, Genscript, Piscataway, NJ) in 100 mM HEPES buffer (N-2-hydroxyethylpiperazine-N’-2-ethanesulfonic acid ...
-
bioRxiv - Biochemistry 2024Quote: ... (NM_005855.4, H-pSL056), RAMP2 (NM_005854.3, H-pSL042) and RAMP3 (NM_005856.3, H-pSL043) were purchased from Genscript (Piscataway, NJ, USA). The DNA construct of the calcitonin receptor C-terminally fused with NanoLuc luciferase [22] (Nluc_FL_CTR (H-pSL054) ...