Labshake search
Citations for GenScript :
1 - 50 of 971 citations for GATOR2 complex protein WDR24 WDR24 Antibody since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
Structural insight into guanylyl cyclase receptor hijacking of the kinase–Hsp90 regulatory mechanismbioRxiv - Biochemistry 2023Quote: ... The protein complex was eluted with the addition of 200 μg/mL of FLAG peptide (DYKDDDD) (GenScript). Protein was subsequently concentrated to >2 mg/mL and used for cryo-EM imaging.
-
bioRxiv - Microbiology 2020Quote: ... Antibodies against nucleocapsid protein of anti-SARS-CoV-2 N protein (Genscript) and GAPDH of anti-GAPDH (Proteintech ...
-
bioRxiv - Microbiology 2020Quote: ... Antibody against nucleocapsid protein of anti-SARS-CoV-2 N protein (Genscript, USA) and GAPDH of anti-GAPDH (Proteintech ...
-
bioRxiv - Microbiology 2024Quote: ... yeast cells displayed with the substrate complex were labeled with iFluor 647 conjugated anti-FLAG and FITC conjugated anti-HA antibodies (GenScript, Nanjing, China). The fluorescence signals of labeled cells were quantitated with Beckman Coulter CytoFLEX Flow Cytometer (Beckman Coulter ...
-
bioRxiv - Biophysics 2023Quote: ... The TRAK1-KIF5B complex was then eluted via prescission protease (GenScript) and subjected to SDS-PAGE.
-
bioRxiv - Cell Biology 2022Quote: sgRNAs were synthesized as complex oligonucleotide pools with several sub-pools (Genscript). Subpools were amplified with PCR ...
-
bioRxiv - Immunology 2023Quote: ... Antibodies were purified with Protein A magnetic beads (GenScript, L00273). Expression vectors for CoV-2196 ...
-
bioRxiv - Immunology 2024Quote: ... Antibodies were purified with Protein A magnetic beads (GenScript, L00273).
-
bioRxiv - Immunology 2024Quote: ... Antibodies were purified with Protein A magnetic beads (GenScript, L00273).
-
bioRxiv - Molecular Biology 2021Quote: ... The complex of GIPR-Gs was assembled by adding 15 μM GIP1-42 (GenScript), 100 μM TCEP ...
-
bioRxiv - Neuroscience 2023Quote: ... Complex was eluted using wash buffer supplemented with 0.2 mg/ml Flag peptide (Genscript). Eluent was concentrated and injected to a Superdex 200 increase 10/300 GL column (GE Healthcare ...
-
bioRxiv - Molecular Biology 2021Quote: ... The purified protein was used for raising polyclonal antibodies in rabbits (Genscript). Optimal detection of SAP05 in phytoplasma-infected plants occurred at a 1:2,000 dilution of the antibody ...
-
bioRxiv - Immunology 2023Quote: ... supernatants containing monoclonal antibodies were purified using Protein A magnetic beads (Genscript), and the purified samples were verified by SDS-PAGE.
-
bioRxiv - Molecular Biology 2024Quote: ... Protein G Magnetic Beads were pre-incubated with V5 antibody (A01724, Genscript) for 4 h and crosslinked with 10 volumes of crosslinking buffer containing 20 mM DMP (3 mg DMP/ml of 0.2 M Boric Acid pH 9 ...
-
bioRxiv - Cell Biology 2021Quote: ... The anti-Mps1 antibodies were generated in rabbits against a recombinant Mps1 protein fragment (residues 440-764) of the protein by Genscript. The company provided affinity purified antibodies that we validated by purifying kinetochores from yeast strains with Mps1 or Mps1-13Myc and confirming that the antibody recognized a protein of the correct molecular weight that migrated more slowly with the 13Myc epitope tags ...
-
bioRxiv - Biophysics 2023Quote: ... The anti-Scm3 antibodies were generated in rabbits against a recombinant Scm3 protein fragment (residues 1-28) of the protein by Genscript. The company provided affinity-purified antibodies that we validated by immunoprecipitating Scm3 from yeast strains with Scm3-V5 and confirming that the antibody recognized a protein of the correct molecular weight that was also recognized by α-V5 antibody (Invitrogen ...
-
bioRxiv - Cell Biology 2024Quote: Protein lysates were incubated with 1 µg mouse anti-V5 antibody (Genscript A01724) for 2 h at 4°C ...
-
bioRxiv - Molecular Biology 2024Quote: ... Twin-strep-tagged proteins were detected using HRP conjugated anti-StrepII antibody (Genscript). Acetylated Histone H4 was detected by Abcam H4 antibody cat no ab177790 ...
-
bioRxiv - Cell Biology 2021Quote: WIPI2d10-364Δ263-295: ATG16L1 (207-230) complex was formed overnight with 5X molar excess peptide (GenScript). Crystals of the complex were grown using hanging drop vapor diffusion method at 4°C ...
-
bioRxiv - Cell Biology 2022Quote: Three subunits of the human mTORC1 complex (mTOR, Raptor, mLST8) were codon-optimized and synthesized (GenScript). The mTOR gene was cloned into a pCAG vector without a tag ...
-
bioRxiv - Biophysics 2024Quote: Antibodies were obtained from the following sources: Protein C-Tag Antibody (HPC4) (Rabbit polyclonal) was from Genscript (Piscataway, NJ, USA); Anti-Phosphotyrosine Antibody ...
-
bioRxiv - Molecular Biology 2020Quote: ... The protein complexes were detected by western blot with anti-His antibody (Genscript, A00186) and anti-Flag antibody (Sigma ...
-
bioRxiv - Cell Biology 2022Quote: ... GiGrx5 and GiBolA proteins were detected by a rabbit anti-BAP polyclonal antibody (GenScript). Mitosomal GiTom40 and GiIscU were detected with a specific polyclonal antibody raised in rabbits (84) ...
-
bioRxiv - Immunology 2023Quote: ... supernatants containing the monoclonal antibodies were purified using protein A magnetic beads (Genscript, L00695). The purified samples were determined by SDS-PAGE.
-
bioRxiv - Immunology 2024Quote: ... and then supernatants containing monoclonal antibodies were purified by Protein A magnetic beads (Genscript). The purified mAb samples were verified by SDS-PAGE.
-
bioRxiv - Biochemistry 2022Quote: ... The lysate was run on separate 12% SDS–polyacrylamide gel and probed using βarr antibody and HRP-coupled protein L antibody (dilution-1:2,000; GenScript; cat. No. M00098) by western blotting ...
-
bioRxiv - Microbiology 2021Quote: Polyclonal Rabbit antibodies against the potential S-Layer protein of A_DKE were generated by GenScript Biotech B ...
-
bioRxiv - Plant Biology 2021Quote: ... Accumulation of FHT-HA protein was assayed by immunoblot with a monoclonal HA antibody (GenScript).
-
bioRxiv - Cell Biology 2020Quote: Our RAD-51 antibody was generated from a His-tagged fusion protein expressed by Genscript from plasmid pET30a containing the entire RAD-51S coding sequence (1385 bp ...
-
bioRxiv - Immunology 2021Quote: ... The lysate was immunoprecipitated using designated primary antibodies with protein G resin (GenScript, Piscataway, NJ), or anti-Flag M2 affinity agarose gel at 4°C ...
-
bioRxiv - Microbiology 2023Quote: ... the purified polyclonal antibodies against RNase E was bound to Protein A/G MagBeads (Genscript), followed by cross-linking using dimethyl pimelidate dihydrochloride (Sigma-Aldrich ...
-
bioRxiv - Biophysics 2023Quote: ... Sup35NM was visualized using an antibody raised against residue 125-253 of the protein(GenScript). Cell lysates were fractionated by SDS-PAGE ...
-
bioRxiv - Microbiology 2023Quote: ... or 9 ug/mL of full-length FimH protein (antigen for custom antibody production, Genscript) was used.
-
bioRxiv - Cell Biology 2022Quote: ... transferred to nitrocellulose membrane and the protein tags were detected by rabbit anti-BAP antibody (Genscript) and rat anti-HA antibody (Roche) ...
-
bioRxiv - Plant Biology 2022Quote: ... His-FmASP protein was detected by immunoblotting with using a mouse anti-His antibody (GenScript, A00186). The immunoblotting band signals were visualized by enhanced enhanced chemiluminescence (ECL ...
-
bioRxiv - Molecular Biology 2023Quote: ... Immunoprecipitations were performed using 0.5μg IgG or RBM10 antibody and protein A magnetic beads (GenScript #L00273) incubated with 2mg lysate overnight at 4°C ...
-
bioRxiv - Plant Biology 2024Quote: Polyclonal antibodies against Arabidopsis proteins PIE1 (AT3G12810) and MBD9 (AT3G01460) were made using services from GenScript. The MBD9 protein fragment ‘MEPSILKEVGEPHNSSYFADQMGCDPQPQEGVGDGVTRDDETSSTAYLNKNQGKSP LETDTQPGESHVNFGESKISSPETISSPGRHELPIADTSPLVTDNLPEKDTSETLLKSVG RNHETHSPNSNAVELPTAHDASSQASQELQACQQDLSATSNEIQNLQQSIRSIESQLL KQSIRRDFLGTDASGRLYWGCCFPDENPRILVDGSISLQKPVQADLIGSKVPSPFLHTV DHGRLRLSPWTYYETETEISELVQWLHDDDLKERDLRESILWWKRLRYGDVQKEKKQ AQNLSAHHHHHH’ was expressed recombinantly and the PIE1 peptide fragment ‘CEEIRKAVFEERIQESKDRAAAI’ was synthesized for use as antigens in polyclonal antibody production in rabbits ...
-
bioRxiv - Cell Biology 2024Quote: ... anti-Okp1 anti-Ame1 antibodies were generated in rabbits against their respective recombinant protein by Genscript. The company provided affinity-purified antibodies for each protein that we validated by immunoprecipitation of the respective target protein from yeast strains with an endogenously V5-tagged (Mif2 ...
-
bioRxiv - Molecular Biology 2022Quote: ... The galanin-GAL1R-Gi complex was formed in membranes by the addition of 5 μM galanin peptide (synthesized by GenScript) and 25 mU/mL apyrase ...
-
bioRxiv - Molecular Biology 2023Quote: ... coli codon-optimized genes for expression of the type III-A Csm complex from Streptococcus thermophilus (SthCsm) were synthesized by GenScript and cloned into three different vectors ...
-
bioRxiv - Molecular Biology 2023Quote: ... we electroporated the same sgRNAs and Cas9 RNP complex with 20 pmol of a 761 nt ssDNA donor repair template (GenScript) harboring a 161 nt knock-in insert and 300 nt homology arms on both sides ...
-
bioRxiv - Molecular Biology 2021Quote: ... with 1 ug of anti-UPF1 or anti-ARS2 antibodies and protein A/G magnetic beads (Genscript). The next day ...
-
bioRxiv - Microbiology 2020Quote: ... The recombinant proteins were subjected to SDS-PAGE followed by immunoblotting using anti-HAT-tag antibody (GenScript) and HRP-conjugated anti-rabbit IgG (Jackson ImmunoResearch) ...
-
bioRxiv - Genetics 2023Quote: Antibodies to all kinetochore proteins used in this study were custom-produced by GenScript (Piscataway, NJ, USA) or Biomatik (Cambridge ...
-
bioRxiv - Plant Biology 2023Quote: ... Equal volumes of the solubilized protein fractions were detected by a polyclonal anti-GFP antibody (GenScript, USA). Rubisco large subunit was used as a loading control.
-
bioRxiv - Molecular Biology 2024Quote: ... Human PANX1 proteins were detected by incubating with THE™ DYKDDDK tag antibody (GenScript; #A00187; 1:1000) at 4 °C for 16-18 hours ...
-
bioRxiv - Microbiology 2020Quote: ... Specific anti-CoV immunoreactivity was detected using an in-house SARS-CoV-2 nucleocapsid protein rabbit antibody (Genscript) at a 1:1000 dilution ...
-
bioRxiv - Immunology 2022Quote: ... The purified protein was used to immunize Wistar rats to generate a panel of monoclonal antibodies by Genscript USA ...
-
bioRxiv - Plant Biology 2022Quote: ... Input and immunoprecipitated HA-MED14 prey proteins were detected using goat anti-HA polyclonal antibodies (GenScript, Piscataway, NJ). The amounts of GST-PIF4 and GST-HMR bait proteins were visualized by staining the SDS-PAGE with Coomassie Brilliant Blue.
-
bioRxiv - Biophysics 2024Quote: ... The expression of PDGFRβ and CSF1R was detected by western-blotting using anti-protein C antibody (Genscript, USA). The phosphorylation levels of PDGFRβ or CSF1R were detected by western-blotting using 4G10 antibody (Merck Millipore ...