Labshake search
Citations for GenScript :
1 - 50 of 718 citations for ETS Related Transcription Factor Elf 3 ELF3 Antibody HRP since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2024Quote: ... This and a related construct, lacking residues 288-478 (denoted H6-HC1_ΔvWFA (Briggs et al., 2020)) were mutated (by Genscript) to remove the non-authentic N-terminal sequence (i.e. ...
-
bioRxiv - Immunology 2020Quote: ... DNA encoding the S protein ectodomains (residues 1-1194) from bat SARS-related CoV isolates Rs4231 and Rs4874 (ref.(Hu et al., 2017)) were synthesized (Genscript) with a C-terminal T4-Foldon domain or C-terminal GCN domain ...
-
bioRxiv - Cell Biology 2020Quote: ... and for generation of EGFP-C2-Arp3B plasmid, the mRNA transcript variant 1 encoding murine actin-related protein 3B (Actr3b) (Jay et al., 2000) was synthesized (GenScript Biotech) and cloned into pEGFP-C2 vector (Clontech).
-
bioRxiv - Molecular Biology 2024Quote: ... using web-based CRISPR-related tools developed by GenScript (https://www.genscript.com), we designed a single guide RNA (sgRNA) ...
-
bioRxiv - Biochemistry 2022Quote: ... Wells were washed 3 times in PBS and incubated with 1:1000 anti-His HRP antibody (GenScript, A00612, Lot. 19K001984) for 1 hour at room temperature ...
-
bioRxiv - Synthetic Biology 2022Quote: ... gRNAs and related sequences were commercially synthesized (Integrated DNA Technologies IDT and GenScript) and then cloned into corresponding entry vectors using In-Fusion cloning (Takara Bio ...
-
bioRxiv - Bioengineering 2020Quote: ... HRP-conjugated secondary antibodies against His-tag (Genscript) were diluted 1:5,000-10,000 and incubated with the well for 1 hr at room temperature ...
-
bioRxiv - Immunology 2022Quote: Selected clonally related heavy sequences were ordered codon-optimized from GenScript (Hong Kong, China) and sub-cloned in the CMV/R expression vector [48,49] ...
-
bioRxiv - Bioengineering 2022Quote: ... An HRP-conjugated anti-camelid VHH antibody cocktail (Genscript) was diluted 50,000-fold in block and 100 μL/well was added to the ELISA plates for 50 minutes with shaking ...
-
bioRxiv - Molecular Biology 2022Quote: ... MonoRabTM HRP Rabbit anti-Camelid VHH antibody (GenScript #A01861) was used to detect vhhGFP fusion proteins ...
-
bioRxiv - Plant Biology 2023Quote: ... and DAO1 DNA sequences (Saidi et al. 2005; Boute et al. 2016; Erikson et al. 2004) were synthesized by GenScript Biotech (https://www.genscript.com ...
-
bioRxiv - Biochemistry 2022Quote: ... 1:1000 anti-His HRP antibody (GenScript, A00612, Lot. 19K001984), 1:1000 anti-HA-Tag (C29F4 ...
-
bioRxiv - Molecular Biology 2022Quote: ... alpha-factor peptide (GenScript) was added to a final concentration of 5 µg/ml for 1.5 hours ...
-
bioRxiv - Cell Biology 2024Quote: ... 10µL of α-factor (GenScript) was added to each well ...
-
bioRxiv - Biophysics 2024Quote: ... and detected by western blotting using HRP-conjugated anti-his antibody (Genscript).
-
bioRxiv - Biochemistry 2024Quote: ... Intrabody expression was detected using an anti-HA HRP conjugated antibody (Genscript) and imaged employing chemiluminescence with the Clarity Western ECL substrate (Bio-Rad ...
-
bioRxiv - Molecular Biology 2023Quote: ... casΦ-2 of Biggiephage (22), a short, non-CIS related AMPs, human ll-37 (Uniprot: P49913, ‘[LL-37, 37 aa]’) afp18ΔC8 from Genscript. The two non-CIS cargos ll-37 and casΦ-2 were cloned into the designed afp18 N-terminal constructs including the first 50 ...
-
bioRxiv - Cell Biology 2022Quote: ... P-factor (TYADFLRAYQSWNTFVNPDRPNL) and α-factor (WHWLQLKPGQPMY) (Custom Peptide Synthesis, 4 mg, ≥95% purity, GenScript Biotech) were dissolved in DMSO to a concentration of 10 mM ...
-
bioRxiv - Genetics 2024Quote: ... HRP-conjugated mouse monoclonal antibody against FLAG was obtained from GenScript (Cat# A01428).
-
bioRxiv - Molecular Biology 2024Quote: ... Twin-strep-tagged proteins were detected using HRP conjugated anti-StrepII antibody (Genscript). Acetylated Histone H4 was detected by Abcam H4 antibody cat no ab177790 ...
-
bioRxiv - Biochemistry 2020Quote: ... the mating pheromone α-factor (GenScript) was added to log phase cultures grown to OD600 of 0.4–0.6 (MATa yeast strain BY4741 ...
-
bioRxiv - Cancer Biology 2022Quote: ... The secondary antibody solution consisted of MonoRab ™: Rabbit Anti-Camelid VHH Antibody [HRP] mAb (GenScript, Cat. # A01861-200) (1:5000 ...
-
bioRxiv - Molecular Biology 2024Quote: ... Other pAAV-related plasmids were developed by modifying these plasmids using standard molecular biology techniques and the GenBuilder Cloning kit (GenScript). PCR primers and oligonucleotides used were obtained from Integrated DNA Technologies (IDT) ...
-
bioRxiv - Molecular Biology 2023Quote: ... and 10 μM ET-1/ IRL1620 (GenScript) for 1.5 h at room temperature (RT) ...
-
bioRxiv - Microbiology 2020Quote: ... or by an HRP-linked rabbit anti-camelid VHH monoclonal antibody (A01861-200, GenScript). After washing 50 µL of TMB substrate (Tetramethylbenzidine ...
-
bioRxiv - Cell Biology 2021Quote: ... Western blot analysis was performed using THETM DYKDDDDK Tag Antibody [HRP-conjugated] (A01428, GenScript) and Monoclonal Anti-polyHistidine−Peroxidase (A7058 ...
-
bioRxiv - Cell Biology 2024Quote: ... Western blot analysis was performed using THETM DYKDDDDK Tag Antibody (HRP-conjugated; A01428, GenScript) and Monoclonal Anti-polyHistidine−Peroxidase (A7058 ...
-
bioRxiv - Genetics 2022Quote: ... potentially due to their age. We additionally attempted to raise new antibodies using the previously published epitopes (Bickel et al. 2010) (synthesized by GenScript) in chickens (SMC-5 ...
-
bioRxiv - Cell Biology 2024Quote: ... α-factor was added to the cells to a final concentration of 5 ng/ml α-factor (GenScript RP01002) for 3 hours ...
-
bioRxiv - Microbiology 2020Quote: ... and developed using enhanced chemiluminescence following incubation with HRP-conjugated goat anti-rabbit antibody (GenScript). Two images were taken of each membrane ...
-
bioRxiv - Microbiology 2023Quote: ... was detected by HRP-conjugated rabbit anti-camelid VHH antibodies (Genscript, A01861-200, 1/5000) or a mouse anti-HA antibody (BioLegend 901501 ...
-
bioRxiv - Immunology 2022Quote: ... et al (HPV16 E7) and Drakes et al (NY-ESO-1, 1G4 and MART-1, DMF5) were ordered from GenScript in the MSGV-retroviral vector (33 ...
-
bioRxiv - Molecular Biology 2021Quote: The substrate for this reaction is a synthetic TNF-derived peptide first developed by Schuster et al (Schuster, Roessler et al., 2016) was synthesized by Genscript. Reactions were performed with 150 mM NaCl ...
-
bioRxiv - Bioengineering 2024Quote: PEmax (pCMV-PEmax-P2A-hMLH1dn (Chen et al., 2021), uPEn (uPEn3) (Li et al., 2023) and PEn were generated by gene synthesis (Genscript). The sequence of PEn corresponds to PEmax with the H840A mutation reversed to the original histidine ...
-
bioRxiv - Plant Biology 2021Quote: ... lycopersici 4287 (SGEISYGALNRDHIPCSVKGASAANCRPGAEANPYNRGCNAIEKCRGGV; GenScript; Thynne et al., 2017).
-
bioRxiv - Biochemistry 2022Quote: ... 10 μl of lysate was then separated by SDS-PAGE and ERK1/2 bands were detected by Western blotting using corresponding antibodies (rabbit phospho-ERK1/2 antibody, 1:5000 dilution; rabbit total ERK1/2 antibody, 1:5000 dilution; anti-rabbit HRP-coupled secondary antibody, Genscript, Cat. No. A00098, 1:10000 dilution). ECL solution from Promega (Cat ...
-
bioRxiv - Biochemistry 2022Quote: ... PVDF membranes were cut and immunoblotted with α-TatA and α-TatB antibodies respectively followed by HRP-conjugated α-rabbit antibody (GenScript). Proteins were visualized using ProSignal Pico ECL Western Blotting detection kit (Genesee Scientific).
-
bioRxiv - Biochemistry 2022Quote: ... The lysate was run on separate 12% SDS–polyacrylamide gel and probed using βarr antibody and HRP-coupled protein L antibody (dilution-1:2,000; GenScript; cat. No. M00098) by western blotting ...
-
bioRxiv - Biochemistry 2022Quote: ... as a C-terminal fusion to an N-terminal small ubiquitin-related modifier (SUMO) tag using BsaI and XhoI (GenScript, Piscataway, NJ, USA). This results in a construct that ...
-
bioRxiv - Immunology 2023Quote: ... a biotinylated rat polyclonal antibody against human Fc was used as a capture antibody and anti-human IgG Fc-HRP (GenScript Cat# A01854-200) as a detection antibody ...
-
bioRxiv - Molecular Biology 2020Quote: ... Polyreactivity was quantified by detecting bound IgG using an HRP-conjugated anti-human IgG secondary antibody (Genscript) and SuperSignal ELISA Femto Maxiumum Sensitivity Substrate (Thermo Scientific) ...
-
bioRxiv - Neuroscience 2021Quote: ... granulocyte colony stimulating factor (G-CSF; GenScript, Piscataway, NJ) was dissolved in 0.9% sterile saline and administered intraperitoneally (IP).
-
bioRxiv - Neuroscience 2024Quote: ... 20 ng/mL Brain-derived neurotrophic factor (BDNF, GenScript), 20 ng/mL Glial Cell Line-derived Neurotrophic Factor (GDNF ...
-
bioRxiv - Neuroscience 2020Quote: ... In white clear bottom 96-well plates 10 μL IL-34 antibody (mouse monoclonal IgG2A (v1.1 manufactured by Genscript, Ma et al., 2012), rat monoclonal IgG2A (MAB5195 ...
-
bioRxiv - Immunology 2020Quote: ... HRP-conjugated RBD (Genscript) were pre-incubated with 1:20 diluted serum at 37°C for 1h ...
-
bioRxiv - Immunology 2021Quote: ... as the primary antibody and anti-Rabbit IgG conjugated to HRP (cat. n° A01827, GenScript, Piscataway, NJ, USA) (2/5000 ...
-
bioRxiv - Synthetic Biology 2020Quote: ... The blots were then washed twice in TBST and incubated with horseradish peroxidase (HRP)-conjugated secondary antibody (GenScript) for 2 hours in TBST ...
-
bioRxiv - Immunology 2023Quote: ... and 10 ng/ml epidermal growth factor (GenScript; cat # Z00333). As keratinocytes attached more tightly to the dishes ...
-
bioRxiv - Biochemistry 2024Quote: ... and then arrested in G1 with alpha-factor (GenScript (RP01002)– 10 mg/ml stock concentration and 10 µg/ml working concentration ...
-
bioRxiv - Cell Biology 2023Quote: ... Primary antibodies were dissolved in 5% BSA (Biofroxx, 4240GR005) and the dilutions were: Streptavidin-HRP (1:2000, GenScript, M00091), RL2 (1:1000 ...