Labshake search
Citations for GenScript :
1 - 50 of 188 citations for Collagen Binding Fragment since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2022Quote: Both collagen binding peptide (CBP, sequence: CNNNLHLERL, Genscript) and scrambled sequence peptide (SCR ...
-
bioRxiv - Molecular Biology 2021Quote: ... at 0.25 µg/ml or rabbit antibody against calmodulin binding peptide Calmodulin Binding Peptide (GenScript) at 0.1 µg/ml ...
-
bioRxiv - Molecular Biology 2023Quote: ... gene fragments (GenScript) encoding the transposase (TnpA ...
-
bioRxiv - Molecular Biology 2023Quote: ... gene fragments (Genscript) of ωRNA encoded downstream of T7 promoter ...
-
bioRxiv - Molecular Biology 2021Quote: ... synthesized as fragments (GenScript), and cloned into the pCDFDuet-1 backbone under control of an IPTG-inducible T7 promoter.
-
bioRxiv - Cell Biology 2023Quote: ... The HA_2 fragment (Genscript) was then ligated to the AAVS1_3xFLAG-6xHis-HA_1 vector at the BstBI/EcoRI sites ...
-
bioRxiv - Molecular Biology 2022Quote: ... a synthesized DNA fragment (Genscript) corresponding to nucleotide positions 31-1446 and that includes mutations T19R ...
-
bioRxiv - Biophysics 2023Quote: ... A synthesized DNA fragment (Genscript) was introduced carrying silent mutations in amino acids T188 and A189 to introduce an EagI site ...
-
bioRxiv - Bioengineering 2020Quote: ... DNA fragments were synthesized by Genscript while oligonucleotides were synthesized by IDT (Integrated DNA Technologies ...
-
bioRxiv - Microbiology 2022Quote: ... a synthetic DNA fragment (GenScript®) containing BAP tag in VP4 loops in amino acid regions 96-101 ...
-
bioRxiv - Microbiology 2021Quote: ... Fragment A was modified by GenScript from thymine to guanine at nucleotide position 1599 and thymine to adenine at position 1601 to generate the Y61E phosphomimetic while nucleotide 1600 was modified from adenine to thymine for the Y61F non-phosphorylatable mutant ...
-
bioRxiv - Genomics 2019Quote: ... we inserted a DNA fragment (Genscript) containing 4 different gRNAs targeting the mCD8 protein tag ...
-
bioRxiv - Genomics 2019Quote: ... a DNA fragment was synthetized (Genscript), which contained 4 gRNAs (6 for Exon2 ...
-
bioRxiv - Biochemistry 2022Quote: ... and a synthesized DNA fragment (GenScript) was used as PCR template.
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... Each fragment was synthesized by GenScript, and once received ...
-
bioRxiv - Biophysics 2022Quote: ... DNA fragments were synthesized by GenScript and cloned into a bacterial expression vector for overexpression and purification (see below) ...
-
bioRxiv - Cancer Biology 2021Quote: The binding kinetics of the VNAR-hFc (produced by GenScript) to hPD-L1-His protein (SinoBiological ...
-
bioRxiv - Systems Biology 2024Quote: ... Calmodulin binding peptide 1 (MLCK peptide) was purchased from Genscript Biotech Corp ...
-
bioRxiv - Genetics 2020Quote: ... fragment 2 was generated by amplification of the kh recoded rescue fragment from a plasmid synthesized by GenScript Inc. ...
-
bioRxiv - Bioengineering 2020Quote: ... heparin-binding peptide (HBP, GCGAFAKLAARLYRKA, 1.0 mM, Genscript, George Town, KY), and fiber segments (0.0-5.0% v/v) ...
-
bioRxiv - Biochemistry 2020Quote: Binding of the fluorescent transport substrate peptide RRY(CFluorescein)KSTEL (Genscript) to WT and mutant TmrAB was determined as a function of the change in fluorescence polarization as described in [10] ...
-
bioRxiv - Biochemistry 2020Quote: ... Synthetic DNA fragments were synthesized by Genscript, Inc ...
-
bioRxiv - Microbiology 2019Quote: ... iii) rGαi-wt Synthetic DNA fragment (GenScript) encoding for E ...
-
bioRxiv - Neuroscience 2021Quote: ... Kozak-4MTS fragment was synthesized by GenScript and cloned into the intermediate plasmid-AAV2-hSyn-linker-jGCaMP8m ...
-
bioRxiv - Microbiology 2019Quote: ... we used a synthetic DNA fragment (Genscript) of 712 bp in length termed p6122 ...
-
bioRxiv - Bioengineering 2022Quote: ... Two GenPart fragments were synthesized from GenScript for each plasmid (OA-1053A or OA-1053B) ...
-
bioRxiv - Microbiology 2024Quote: ... DNA fragments were synthesized de novo (Genscript) and amplified by PCR ...
-
bioRxiv - Biophysics 2019Quote: ... A putative SH3-binding peptide (Ac-PLPPLPRRALSVW-NH2) was synthesized by GenScript. Samples containing 200 μM 15N-labeled cSH3 were prepared at 0- ...
-
bioRxiv - Immunology 2022Quote: ... 2 µg/ml MHC-I binding SIINFEKL peptide (ovalbumin 257-264, GenScript), or 2 µg/ml ISQAVHAAHAEINEAGR MHC-II binding peptide (ovalbumin 323-339 ...
-
bioRxiv - Neuroscience 2022Quote: ... Plasmids containing the N171 N-terminal fragment sequence of human HTT bearing either 85 CAG repeats (HTT85Q, pathological HTT fragment) or 10 CAG repeats (HTT10Q, control HTT fragment) were manufactured by GenScript and subsequently cloned into a transgene cassette flanked by viral inverted terminal repeats (ITRs) ...
-
bioRxiv - Microbiology 2020Quote: ... DNA fragments with swapped SPs were synthesized (Genscript) and digested using EcoRI (in pNL4.3 backbone ...
-
bioRxiv - Microbiology 2020Quote: ... was obtained as synthetic DNA fragment from GenScript Biotech (Netherlands ...
-
bioRxiv - Microbiology 2020Quote: ... Fragment 4 was ordered as synthetic sequence (GenScript) with the first 274 bp recodonised and was amplified from plasmid pUC57-re-ap2-hc-1 using primers ap2-hc-5'_HR2_re_F and ap2-hc-5'_HR2_re_R.
-
bioRxiv - Microbiology 2020Quote: ... Two additional fragments were de novo synthesized (Genscript) and amplified by PCR (primers are listed in Table S6) ...
-
bioRxiv - Immunology 2021Quote: ... Two gBlock gene fragments were synthesized by Genscript to encode the modified TCRα chain ...
-
bioRxiv - Developmental Biology 2022Quote: Peptide fragments covering amino acids 55-66 (Genscript) and His-tagged recombinant extracellular domain of Human PTH1R (Cat ...
-
bioRxiv - Microbiology 2022Quote: ... and each DNA fragment was commercially synthesized (GenScript). A T7 promoter sequence was introduced at the 5′ end of fragment A ...
-
bioRxiv - Microbiology 2023Quote: ... and each DNA fragment was commercially synthesized (GenScript). A T7 promoter sequence was introduced at the 5’ end of fragment A ...
-
bioRxiv - Cell Biology 2023Quote: ... The NEFL homology arm (HA)_1 fragment (Genscript) was cloned into the AAVS1_3xFLAG-6xHis vector at the Nde1/NcoI sites ...
-
bioRxiv - Molecular Biology 2021Quote: ... and a rabbit polyclonal antibody specific for calmodulin-binding peptide (A00635-40, GenScript), a Goat anti-Rabbit IgG (H+L ...
-
bioRxiv - Bioengineering 2022Quote: ... Peptides for zinpyr-1 competition binding assay were synthesized by GenScript (Piscataway, NJ). Reagents for making competent E.coli cells were obtained from Zymo Research (Irvine ...
-
bioRxiv - Immunology 2022Quote: ... or 2 µg/ml ISQAVHAAHAEINEAGR MHC-II binding peptide (ovalbumin 323-339, GenScript) was added ...
-
bioRxiv - Molecular Biology 2022Quote: To determine the binding affinity of a TF-ARM peptides (synthesized by Genscript) with 7SK RNA ...
-
bioRxiv - Immunology 2020Quote: ... The sMVA fragments were produced and assembled by Genscript using chemical synthesis ...
-
bioRxiv - Microbiology 2019Quote: ... was generated with a GenParts™ DNA Fragment (GenScript) containing NSP5 ORF lacking the amino acids 80-130 (VKTNADAGVSMDSSAQSRPSSNVGCDQVDFSLNKG LKVKANLDSSISIST ...
-
bioRxiv - Neuroscience 2023Quote: ... DNA fragment synthesis and cloning were performed by GenScript. pLV-hSyn-glGFP were generated by removing the AgeI-RFP-PmeI insert of pLV-hSyn-RFP and ligating an AgeI-green lantern GFP -PacI-PmeI synthetic fragment ...
-
bioRxiv - Cell Biology 2024Quote: ... a synthetic gene fragment of VPS5 (ordered from GenScript) containing containing the following mutations - start codon of VAM10 sequence(M-to-I) ...
-
bioRxiv - Cell Biology 2019Quote: ... and then synthesized as NdeI-BamHI fragments in pUC57 (GenScript). For expression in HeLa cells ...
-
bioRxiv - Microbiology 2022Quote: pPB-cytBirA was obtained from a synthetic DNA fragment (Genscript) containing the BirA enzyme open reading frame of Escherichia coli (UniProt accession number ...
-
bioRxiv - Developmental Biology 2023Quote: ... of a synthetic FseI-HA-KRAB-AscI DNA fragment (GenScript) flanked by 50 nucleotide homology arms into Puro-dCas9 donor cut FseI-AscI and the plasmid backbone was further replaced with one containing a low copy number origin of replication ...