Labshake search
Citations for GenScript :
1 - 50 of 497 citations for Autophagy Related 4B Cysteine Peptidase ATG4B Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2019Quote: ... control non-related target knockdown (5′-AGTGGATTCGAG-AGCGTGT-3′) (GenScript). To produce lentiviral particles ...
-
bioRxiv - Synthetic Biology 2022Quote: ... gRNAs and related sequences were commercially synthesized (Integrated DNA Technologies IDT and GenScript) and then cloned into corresponding entry vectors using In-Fusion cloning (Takara Bio ...
-
bioRxiv - Biochemistry 2020Quote: ... Cysteine-less ABCB10 (ABCB10-CL; codon-optimized, Genscript) was expressed ...
-
bioRxiv - Microbiology 2021Quote: ... Peptides with terminal cysteines were synthesized by GenScript and diluted to 200 µM in T150 buffer ...
-
bioRxiv - Bioengineering 2024Quote: ... methacrylated HA was functionalized with cysteine-TMR (Genscript) at a concentration of 0.075 mM ...
-
bioRxiv - Immunology 2022Quote: Selected clonally related heavy sequences were ordered codon-optimized from GenScript (Hong Kong, China) and sub-cloned in the CMV/R expression vector [48,49] ...
-
bioRxiv - Biophysics 2020Quote: ... Lysine-Cysteine-Lysine-Deca-histidine peptide was purchased from GenScript. Purified mouse CD45RABC extracellular domain with a C-terminal 6-His tag (accession # ...
-
bioRxiv - Biophysics 2020Quote: CPSF6 peptide (P313-G327) with C-terminal cysteine (PVLFPGQPFGQPPLGC, Genscript) and FEZ1 peptide (M174-L188 ...
-
bioRxiv - Neuroscience 2024Quote: ... where the cysteine at position 29 was replaced by aspartic acid (Genscript). The synthesized constructs were injected into flies and targeted to attP1 or attP2 insertion sites on the second or third chromosomes respectively and the transgenic progeny were balanced either over CyO or TM6C (BestGene) ...
-
bioRxiv - Molecular Biology 2023Quote: ... casΦ-2 of Biggiephage (22), a short, non-CIS related AMPs, human ll-37 (Uniprot: P49913, ‘[LL-37, 37 aa]’) afp18ΔC8 from Genscript. The two non-CIS cargos ll-37 and casΦ-2 were cloned into the designed afp18 N-terminal constructs including the first 50 ...
-
bioRxiv - Immunology 2020Quote: ... DNA encoding the S protein ectodomains (residues 1-1194) from bat SARS-related CoV isolates Rs4231 and Rs4874 (ref.(Hu et al., 2017)) were synthesized (Genscript) with a C-terminal T4-Foldon domain or C-terminal GCN domain ...
-
bioRxiv - Molecular Biology 2024Quote: ... Other pAAV-related plasmids were developed by modifying these plasmids using standard molecular biology techniques and the GenBuilder Cloning kit (GenScript). PCR primers and oligonucleotides used were obtained from Integrated DNA Technologies (IDT) ...
-
bioRxiv - Cell Biology 2020Quote: ... and for generation of EGFP-C2-Arp3B plasmid, the mRNA transcript variant 1 encoding murine actin-related protein 3B (Actr3b) (Jay et al., 2000) was synthesized (GenScript Biotech) and cloned into pEGFP-C2 vector (Clontech).
-
bioRxiv - Bioengineering 2021Quote: ... and 14.1mg/mL di-cysteine modified Matrix Metallo-protease (MMP) (Ac-GCRDGPQGIWGQDDRCG-NH2) (Genscript) peptide substrate were used to form MMP-degradable PicoShells.
-
bioRxiv - Bioengineering 2019Quote: ... flanked by two cysteine residues (VPM peptide, GCRDVPMSMRGGDRCG, purity 96.9%, Mw 1696.96 Da, GenScript). Cells and/or soluble molecules ...
-
bioRxiv - Biophysics 2020Quote: ... and FEZ1 peptide (M174-L188, with N-terminal extension containing a cysteine residue (KCGGSGGMMQNSPDPEEEEEVL, Genscript) were labelled with Alexa Fluor 488-C5-maleimide at 1:1 molar ratio in 50 mM Tris ...
-
bioRxiv - Biochemistry 2022Quote: ... as a C-terminal fusion to an N-terminal small ubiquitin-related modifier (SUMO) tag using BsaI and XhoI (GenScript, Piscataway, NJ, USA). This results in a construct that ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Each 7-mer D-peptide with an N-terminal cysteine was synthesized by GenScript (Piscataway, NJ). Peptides were conjugated with IRDye 800CW maleimide (Li-Cor ...
-
bioRxiv - Biophysics 2019Quote: A synthetic peptide from CPSF6 comprising residues 313-327 with a C-terminal cysteine (PVLFPGQPFGQPPLGC, Genscript) was dissolved (1.85 mM ...
-
bioRxiv - Bioengineering 2020Quote: ... The other solution contained an 8mM di-cysteine modified Matrix Metalloprotease (MMP) (Ac-GCRDGPQGIWGQDRCG-NH2) (GenScript) substrate with either all L-chirality amino acid residues for L-MMP microgels or D-chirality amino acid substitution of amino acids at the site of MMP-mediated recognition and cleavage (Ac-GCRDGPQDGIDWDGQDRCG-NH2 ...
-
bioRxiv - Plant Biology 2021Quote: ... The filtered supernatant was mixed with 2 mL slurry of previously washed and equilibrated Glutathione Sepharose 4B beads (GenScript). After incubation ...
-
bioRxiv - Cell Biology 2019Quote: ... DOPE-MPB lipids were then reacted with the terminal cysteine residue of a fluorescent CtermCldn4 peptide (300 nM, 5-FAM-Ahx-CPPRTDKPYSAKYSAARSAAASNYV, GenScript) for 1 hr at room temperature ...
-
bioRxiv - Cell Biology 2021Quote: ... cysteine terminated IKVAV and AG73 peptides (full sequences for IKVAV and AG73: CSRARKQAASIKVAVSADR, and CGGRKRLQVQLSIRT respectively, GenScript Biotech, Piscataway, NJ) were dissolved in 1X PBS pH 3.25 ...
-
bioRxiv - Synthetic Biology 2022Quote: ... linker with both N-terminal and C-terminal 10×His-tags with a cysteine adjacent to each 10×His tag in a pET21b vector (Genscript). The plasmid was transformed into T7 express cells (NEB ...
-
bioRxiv - Biochemistry 2021Quote: Custom antibodies were generated in rabbits against the peptide CEHRKRFDEERLRFL corresponding to amino acids 297-310 of PfKelch13 sequence (the cysteine at the N-terminus was added for conjugation to KLH) by Genscript Inc ...
-
bioRxiv - Biochemistry 2020Quote: Immunogen peptide S2 (ACNH-CGAGT(AMP)GAG-NH2) was conjugated with KLH and BSA as immunogen via its N-terminal cysteine (GenScript).
-
bioRxiv - Microbiology 2023Quote: ... An extracellular membrane-proximal sequence from residues 236-277 (ENRKVSVVKTRQDRR) with an N-terminal cysteine was generated and covalently linked to KLH (Genscript). BALB/c mice were intraperitoneally-immunized with 25 µg of the KLH-peptide conjugate emulsified in incomplete Freund’s adjuvant (IFA ...
-
bioRxiv - Biophysics 2023Quote: The peptides CPSF6313–327 (CPSF6p) and CPSF6313–327 with an extra cysteine at the C-terminus (CPSF6p-Cys) were synthetized by GenScript. Peptides were dissolved in water at a concentration of 2.5 mM and stored in aliquots at -40°C.
-
bioRxiv - Cell Biology 2022Quote: ... A cysteine is added to the N terminus of each peptide for coupling chemistry and the peptides are synthesized by GenScript (Inc.). The purity of the three peptides are 96.9% ...
-
bioRxiv - Microbiology 2022Quote: ... or mouse anti-FLAG antibody (anti-DYKDDDDK antibody, Genscript) with Pierce ECL Western Blotting Substrate (Thermo Fisher Scientific).
-
bioRxiv - Pharmacology and Toxicology 2022Quote: ... anti-cGMP antibody (PerkinElmer anti-cGMP antibody: final dilution1:8000, Genscript anti-cGMP antibody ...
-
bioRxiv - Immunology 2020Quote: ... Commercial antibodies tested also included a human IgG chimeric antibody from GenScript (SARS-CoV-2 spike S1 Antibody (HC2001), GenScript #A02038 ...
-
bioRxiv - Microbiology 2023Quote: ... 0.874 mg/mL anti-FimH polyclonal antibody (custom antibody produced by Genscript) or 0.96 mg/mL anti-Muc2 (Novus) ...
-
bioRxiv - Genomics 2021Quote: ... H2A.X and H2A.Z antibodies are affinity-purified rabbit polyclonal antibodies made by GenScript USA Inc (Piscataway ...
-
bioRxiv - Microbiology 2022Quote: ... The following primary antibodies were used at 1:5000 dilution: anti-FLAG antibody (GenScript), and anti-GAPDH antibody (Proteintech) ...
-
bioRxiv - Plant Biology 2020Quote: ... anti-pT25 OsMKK1 antibody (GenScript), anti-ACT1 antibody (Beijing Protein Innovation) ...
-
bioRxiv - Microbiology 2019Quote: ... Anti-FLAG antibody (GenScript #A00187) was incubated in 10% FBS and 1xPBS for 1 h at 37°C at a concentration of 1μg/mL ...
-
bioRxiv - Microbiology 2022Quote: ... antibodies for α-Cis1a (GenScript) and α-Cis2 (GenScript ...
-
bioRxiv - Cell Biology 2023Quote: ... A rabbit polyclonal antibody (Genscript) produced against full-length Drosophila p23 (Q9VH95 ...
-
bioRxiv - Cell Biology 2024Quote: Antibodies were produced by GenScript USA (Piscataway ...
-
bioRxiv - Synthetic Biology 2023Quote: ... Anti-streptag purified antibody (Genscript) was also APC conjugated ...
-
bioRxiv - Cell Biology 2024Quote: Antibodies were produced by GenScript USA (Piscataway ...
-
bioRxiv - Molecular Biology 2022Quote: ... The midguts were then incubated with primary antibody for liberibacter with anti-OmpB-antibody (GenScript), followed by secondary antibody conjugated with Cy3/Cy5 (Jackson ImmunoResearch Laboratories) ...
-
bioRxiv - Microbiology 2023Quote: ... was used to amplify signals from anti-FimH polyclonal antibody (custom antibody produced by Genscript). Slides were counterstained using 10 mg/mL bisBenzimide H 33258 dissolved in TBS for 20 minutes in the dark at room temperature then cover slipped ...
-
bioRxiv - Immunology 2023Quote: Neutralizing antibodies were assessed using the cPass SARS-CoV-2 Neutralization Antibody Detection Kit (GenScript) according to manufacturer’s instructions with the following changes ...
-
bioRxiv - Biochemistry 2022Quote: ... 10 μl of lysate was then separated by SDS-PAGE and ERK1/2 bands were detected by Western blotting using corresponding antibodies (rabbit phospho-ERK1/2 antibody, 1:5000 dilution; rabbit total ERK1/2 antibody, 1:5000 dilution; anti-rabbit HRP-coupled secondary antibody, Genscript, Cat. No. A00098, 1:10000 dilution). ECL solution from Promega (Cat ...
-
bioRxiv - Physiology 2019Quote: ... The primary antibody was prepared using a custom affinity-purified rabbit polyclonal antibody (Genscript, Piscataway, NJ) produced against Rhodnius prolixus RhoprCAPA-2 (EGGFISFPRV-NH2 ...
-
bioRxiv - Molecular Biology 2020Quote: ... Flag antibody was purchased from GenScript. PPP2CA (I3482-I-AP) ...
-
bioRxiv - Microbiology 2022Quote: Antibody genes were synthesized by Genscript and recombinantly produced in a human IgG backbone ...
-
bioRxiv - Microbiology 2021Quote: ... Purified antibody was produced by Genscript as human IgG in HD 293F mammalian cells ...