Labshake search
Citations for GenScript :
401 - 450 of 548 citations for Ubiquitin thioesterase ZRANB1 ZRANB1 Antibody HRP since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2023Quote: The p53-5H7B9 mouse monoclonal antibody (subclass IgG2a) was purchased from GenScript (catalog number A01767-40) as lyophilized protein in PBS ...
-
bioRxiv - Plant Biology 2024Quote: Polyclonal antibodies against Arabidopsis proteins PIE1 (AT3G12810) and MBD9 (AT3G01460) were made using services from GenScript. The MBD9 protein fragment ‘MEPSILKEVGEPHNSSYFADQMGCDPQPQEGVGDGVTRDDETSSTAYLNKNQGKSP LETDTQPGESHVNFGESKISSPETISSPGRHELPIADTSPLVTDNLPEKDTSETLLKSVG RNHETHSPNSNAVELPTAHDASSQASQELQACQQDLSATSNEIQNLQQSIRSIESQLL KQSIRRDFLGTDASGRLYWGCCFPDENPRILVDGSISLQKPVQADLIGSKVPSPFLHTV DHGRLRLSPWTYYETETEISELVQWLHDDDLKERDLRESILWWKRLRYGDVQKEKKQ AQNLSAHHHHHH’ was expressed recombinantly and the PIE1 peptide fragment ‘CEEIRKAVFEERIQESKDRAAAI’ was synthesized for use as antigens in polyclonal antibody production in rabbits ...
-
bioRxiv - Plant Biology 2024Quote: ... the membrane was incubated in the same solution with RFP-tag primary antibody (GenScript, ref. A00682) at a 1/200 dilution for 1h at room temperature ...
-
bioRxiv - Biochemistry 2024Quote: ... The eluates were analyzed by SDS-PAGE and Western blotting using anti-GST antibodies (GenScript, A0086640), anti-MED14 antibodies (Bethyl Laboratories ...
-
bioRxiv - Developmental Biology 2024Quote: ... The antibody was then antigen-affinity-purified from sera and tested by indirect ELISA by Genscript. For anti-Marcksl1 ...
-
bioRxiv - Neuroscience 2024Quote: ... The antibody was produced in rabbit and affinity-purified by GenScript (Nanjing GenScript Biotech Co., Ltd). Subsequent washes with PBST were carried out for 1 hour at 4℃ ...
-
bioRxiv - Cell Biology 2024Quote: ... anti-Okp1 anti-Ame1 antibodies were generated in rabbits against their respective recombinant protein by Genscript. The company provided affinity-purified antibodies for each protein that we validated by immunoprecipitation of the respective target protein from yeast strains with an endogenously V5-tagged (Mif2 ...
-
bioRxiv - Cell Biology 2024Quote: ... Serum from the final bleed was affinity-purified using the High-Affinity Antibody Purification Kit (GenScript) and used for immunoblotting experiments (1:200-1:500 dilutions).
-
bioRxiv - Molecular Biology 2021Quote: ... with 1 ug of anti-UPF1 or anti-ARS2 antibodies and protein A/G magnetic beads (Genscript). The next day ...
-
bioRxiv - Microbiology 2020Quote: ... The recombinant proteins were subjected to SDS-PAGE followed by immunoblotting using anti-HAT-tag antibody (GenScript) and HRP-conjugated anti-rabbit IgG (Jackson ImmunoResearch) ...
-
bioRxiv - Microbiology 2021Quote: ... Monoclonal anti-CodY antibody was generated by injection of CodY into the BALB/C mouse (Genscript, USA). Mouse anti-CodY IgG monoclonal antibody (IgG ...
-
bioRxiv - Immunology 2022Quote: ... the following pairs of primary antibodies were used: 1) TCRα-TCRβ crosslinking: rabbit anti-c-Myc (Genscript) and mouse anti-V5 (Genscript) ...
-
bioRxiv - Microbiology 2022Quote: ... Specific anti-CoV immunoreactivity was detected using SARS-CoV-2 nucleocapsid antibody (GenScript Biotech, Piscataway, NJ, USA) at a 1:1000 dilution ...
-
bioRxiv - Developmental Biology 2020Quote: ... Sections were incubated with 1 µg/ml of a custom-made MMP13 rabbit polyclonal primary antibody (GenScript, Piscataway ...
-
bioRxiv - Immunology 2021Quote: ... Genes encoding the antibody heavy and light chains were commercially synthesized and cloned into pcDNA3.1 vector (GenScript). DNA primers for sequencing and insert amplification were ordered from IDT.
-
bioRxiv - Microbiology 2021Quote: ... CR3022 antibody heavy and light chain genes were synthesised and subcloned into pcDNA3.4 vector by Genscript (USA).
-
bioRxiv - Immunology 2023Quote: ... Genes encoding the antibody heavy and light chains were commercially synthesized and cloned into pcDNA3.1 vector (GenScript). DNA primers for sequencing and insert amplification were ordered from IDT.
-
bioRxiv - Microbiology 2023Quote: ... 0.6 mg/mL mouse anti-FimH (Sokurenko (mouse samples) or custom antibody produced by Genscript (bacterial samples), 0.1 mg/mL anti-GroEL (Enzo) ...
-
bioRxiv - Microbiology 2023Quote: ... gH was detected using custom-made polyclonal rabbit antibodies raised against peptides derived from KSHV gH (Genscript).
-
bioRxiv - Neuroscience 2023Quote: ... # E7) in 5% non-fat milk TBST and FOLR1 antibody in 5% non-fat milk TBST (GenScript). Anti-GFP antibody or normal rabbit IgG were used as controls in FOLR1-CD2AP co-IP experiments.
-
bioRxiv - Plant Biology 2023Quote: ... Equal volumes of the solubilized protein fractions were detected by a polyclonal anti-GFP antibody (GenScript, USA). Rubisco large subunit was used as a loading control.
-
bioRxiv - Microbiology 2023Quote: ... A rabbit anti-SARS-CoV-2 neutralizing antibody (4G6) was purchased from Genscript (Cat. No. A02053-100). Rabbit monoclonal antibodies against 6-His-tags (12698S ...
-
bioRxiv - Genetics 2023Quote: Antibodies to all kinetochore proteins used in this study were custom-produced by GenScript (Piscataway, NJ, USA) or Biomatik (Cambridge ...
-
bioRxiv - Molecular Biology 2024Quote: ... Human PANX1 proteins were detected by incubating with THE™ DYKDDDK tag antibody (GenScript; #A00187; 1:1000) at 4 °C for 16-18 hours ...
-
bioRxiv - Immunology 2024Quote: Antibody heavy and light chain genes were first optimized for human cell expression and synthesized by GenScript. VH and VL segments were separately inserted into plasmids (pCMV3-CH ...
-
bioRxiv - Immunology 2024Quote: Antibody heavy and light chain genes were first optimized for human cell expression and synthesized by GenScript. VH and VL segments were separately inserted into plasmids (pCMV3-CH ...
-
bioRxiv - Plant Biology 2024Quote: ... were used in combination with horseradish peroxidase-conjugated goat anti-rabbit antibody (GenScript, Piscataway, NJ, USA; A00098). Proteins were then imaged using the Gel Imager (Fusion FX ...
-
bioRxiv - Microbiology 2022Quote: ... The samples were then incubated with the primary antibodies: rabbit anti-α-actin (200×, GenScript, New Jersey, USA), mouse anti-α-actin (400× ...
-
bioRxiv - Microbiology 2020Quote: ... Specific anti-CoV immunoreactivity was detected using an in-house SARS-CoV-2 nucleocapsid protein rabbit antibody (Genscript) at a 1:1000 dilution ...
-
bioRxiv - Immunology 2021Quote: ... Antibody VH or VL sequences were cloned into plasmids containing an IgG1 or relevant light chain backbone (Genscript) and used to transfect Expi293 cells (ThermoFisher Scientific) ...
-
bioRxiv - Immunology 2020Quote: Neutralizing antibodies were routinely detected based on the SARS-CoV-2 Surrogate Virus Neutralization Test (sVNT) kit (GenScript). This ELISA-based kit detects antibodies that hinder the interaction between the receptor binding domain (RBD ...
-
bioRxiv - Immunology 2023Quote: ... the transduction rate of lentivirus on Car-T cells was analyzed by FITC-anti-VHH antibody (GenScript Inc.). Target cells were detected for NKG2D ligands using anti-MICA/MICB and anti-ULBP2/5/6 ...
-
bioRxiv - Bioengineering 2023Quote: ... Cells were subsequently washed with PBS and stained with α-camelid VHH antibodies (1:100, clone 96A3F5, Genscript) in 200 µl Cell Staining buffer for 30 min at 4 °C ...
-
bioRxiv - Immunology 2023Quote: ... Antibody VH or VL sequences were cloned into plasmids containing an IgG1 or relevant light chain backbone (GenScript) and transfected into Expi293 cells (Thermo Fisher Scientific) ...
-
bioRxiv - Immunology 2023Quote: Antibody heavy chain and light chain genes were synthesized and cloned into plasmids containing the CMV promoter (GenScript). Final heavy and light chain plasmids were amplified ...
-
bioRxiv - Immunology 2023Quote: ... Genes encoding the antibody heavy and light chains were similarly synthesized and cloned into the pcDNA3.1 vector (GenScript). Oligonucleotides were synthesized by IDT ...
-
bioRxiv - Immunology 2022Quote: ... The purified protein was used to immunize Wistar rats to generate a panel of monoclonal antibodies by Genscript USA ...
-
bioRxiv - Plant Biology 2022Quote: ... Input and immunoprecipitated HA-MED14 prey proteins were detected using goat anti-HA polyclonal antibodies (GenScript, Piscataway, NJ). The amounts of GST-PIF4 and GST-HMR bait proteins were visualized by staining the SDS-PAGE with Coomassie Brilliant Blue.
-
bioRxiv - Molecular Biology 2024Quote: ... The membrane was blocked (PBS, 5% non-fat milk) and probed with rabbit anti-DYDDDDK primary antibody (GenScript, 1:2,500 ...
-
bioRxiv - Neuroscience 2024Quote: ... Tween20) for 1h and probed with the following primary antibodies: rabbit anti-DYKDDDDK-tag (1:2000, GenScript, #A00170) and mouse anti-actin (1:1000 ...
-
bioRxiv - Biophysics 2024Quote: ... The expression of PDGFRβ and CSF1R was detected by western-blotting using anti-protein C antibody (Genscript, USA). The phosphorylation levels of PDGFRβ or CSF1R were detected by western-blotting using 4G10 antibody (Merck Millipore ...
-
bioRxiv - Plant Biology 2024Quote: Primary antibodies against ApcG and ApcI were raised immunizing rabbits with the purified proteins (Supp. Figure S4) (Genscript). Bleedings from rabbits were used in dilutions of 0.25 mL into 1 mL of TBS-T ...
-
bioRxiv - Microbiology 2020Quote: ... Membranes were blocked with 5% milk in PBS+0.1%Tween-20 and probed with anti-EnvP sera or mouse anti-GAPDH antibody (Genscript), followed by goat anti-mouse HRP (Invitrogen ...
-
bioRxiv - Neuroscience 2021Quote: ... Primary antibodies used in the study were mouse anti-FLAG (1:1000; Cat. No. A00187-200, Genscript, NJ, USA), chicken anti-GFP (1:2000 ...
-
bioRxiv - Genomics 2021Quote: ... Amplification of VH and VL antibody fragments was carried out according to the standard operating procedure (GenScript, NJ, USA) which involves rapid amplification of cDNA ends ...
-
bioRxiv - Evolutionary Biology 2021Quote: ... This 338aa protein fragment was then expressed in E.coli and used to immunize two rabbits for antibody production by GenScript. ELISA titer > 1:128,000 and target protein fragment binding validation by western blot and cell line overexpression.
-
bioRxiv - Microbiology 2021Quote: ... Production of FLAG-tagged transporter proteins was assessed by western blotting using anti-FLAG antibody (Genscript, Piscataway, NJ, USA) as described previously (5).
-
bioRxiv - Immunology 2022Quote: ... 6 and 8 were analyzed with the cPass™ SARS-CoV- 2 neutralization antibody detection kit (GenScript, Cat #L00847) to detect any antibodies that neutralize the interaction between the RBDdelta and the ACE2 receptor ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... we used custom polyclonal antibodies raised against recombinant fragment antigens generated by rabbits’ immunization (GenScript, Piscataway Township, NJ, USA). Each recombinant fragment was injected into three rabbits ...
-
bioRxiv - Microbiology 2023Quote: ... The immunization of rabbits and affinity purification of p239-specific polyclonal antibody from immunized rabbits were conducted by Genscript Co ...