Labshake search
Citations for GenScript :
401 - 450 of 864 citations for 1 3 Nitro 10 11 dihydro 5H dibenzo b f azepin 5 yl ethanone since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2021Quote: ... a SARS-CoV-2 S gene encoding residues 1-1138 (WuhanHu-1; GenBank: MN908947.3) was ordered (Genscript) and cloned into a pPPI4 plasmid containing a T4 trimerization domain followed by a hexahistidine tag by PstI-BamHI digestion and ligation ...
-
bioRxiv - Biochemistry 2024Quote: ... Clarified lysate from 1 L of culture was incubated with 1 mL of equilibrated Ni-resin (Genscript) and washed with 30 mL wash buffer (50 mM Tris pH 7.5 ...
-
bioRxiv - Immunology 2021Quote: ... One million cells per well were added to a U-bottom 96-well plate and were stimulated with 5 μg/ml of pools of overlapping SARS-CoV-2 S protein peptides (GenScript USA Inc, Piscataway, NJ). The stimulation was performed by incubation for 6 h at 37°C and 5% CO2 in the presence of Protein Transport Inhibitor Cocktail (brefeldin A ...
-
bioRxiv - Molecular Biology 2021Quote: ... 5 µM of polymerase module was mixed with 15 µM Mpe1 and either 10 µM Cft2(S) or 720 µM of a synthetic yPIM peptide (GenScript). For full length Cft2 ...
-
bioRxiv - Immunology 2021Quote: Active EAE was induced in 8-10 week old male and female mice by subcutaneous immunization with murine MOG35-55 peptide (Genscript) and complete Freund’s adjuvant ...
-
bioRxiv - Biochemistry 2021Quote: 50 nM of SpNatC was mixed with 30 μM [14C]acetyl-CoA and 10 μM of MLRF peptide (NH2-ML RFVTKRWGRPVGRRRRPCOOH, GenScript), with none ...
-
bioRxiv - Neuroscience 2022Quote: ... Plasmids containing the N171 N-terminal fragment sequence of human HTT bearing either 85 CAG repeats (HTT85Q, pathological HTT fragment) or 10 CAG repeats (HTT10Q, control HTT fragment) were manufactured by GenScript and subsequently cloned into a transgene cassette flanked by viral inverted terminal repeats (ITRs) ...
-
bioRxiv - Immunology 2022Quote: For immunoprecipitation, 10×106 human peripheral blood monocytes cells were treated with SARS-CoV-2 Spike protein (RBD, His Tag) (GenScript) 100 ng/ml for 2 hours ...
-
bioRxiv - Immunology 2020Quote: ... BMDCs (105 cells) were incubated overnight in the presence of 10 μg/ml of influenza HA518–526 (IYSTVASSL) peptide (Genscript). IMALs were isolated from treated mice and A205804 was added to the plate for 5 d ...
-
bioRxiv - Biochemistry 2020Quote: ... compared to the N-terminal SL-that occurs natively after removal of the start Met.10 The cDNA (Figure S1A) was synthesized and provided in pUC57 by GenScript, excised using NcoI and BamHI ...
-
bioRxiv - Biophysics 2021Quote: ... Both ghrelin receptor–Gq complexes were formed on the membrane in the presence of 10 μM ligands (ghrelin or GHRP-6, synthesized by GenScript) and treated with apyrase (25 mU/ml ...
-
bioRxiv - Cell Biology 2024Quote: ... and eluted from the column by incubation with either reduced glutathione (to retain the GST tag) or with 10 units Prescission Protease (Genscript) to obtain protein without a tag ...
-
bioRxiv - Molecular Biology 2023Quote: ... The pBY011 plasmid encoding yeast CHD1 gene under the GAL1/10 promoter was obtained from a DNASU plasmid repository and altered by GenScript, where FLAG tag and NES-NES sequences were added to the N- and C-termini of the gene ...
-
bioRxiv - Genomics 2024Quote: ... DNA pull-downs were performed as described in 29 with 10 ug of DNA oligo for each pull-down (unmodified, methylated, and hydroxymethylated; GenScript) and 400 ug of nuclear extract ...
-
bioRxiv - Immunology 2024Quote: ... Gametocyte extract and 230CMB 21 samples were mixed with 4× NuPAGE™ LDS sample buffer and heated for 10 minutes at 70°C before loading on a 4–20% Bis-Tris gel (GenScript). 20 ng 230CMB was loaded per well and the Precision Plus Dual Color protein marker (Bio-Rad ...
-
bioRxiv - Immunology 2024Quote: ... G12V-TCR alpha chain (1-206) and G12V-TCR beta chain (1-246) were synthesized by Genscript (USA) and cloned into the pET30a+ vector ...
-
bioRxiv - Bioengineering 2023Quote: ... The synthetic peptides AM1 (theoretical Mw = 2472 g·mol-1) and SurSi (theoretical Mw = 3632 g·mol-1) were designed in our lab and synthesized by GenScript® (Nanjing ...
-
bioRxiv - Cancer Biology 2023Quote: ... 1% penicillin-streptomycin) supplemented with 50 mM 2-mercaptoethanol and 1 μg/ml OVA257-264 (SIINFEKL) peptide (GenScript) at at 37 °C and 5% CO2 for 3 days ...
-
bioRxiv - Neuroscience 2021Quote: ... 1 μM CabTRP Ia (GenScript, Piscataway, NJ) was added to the saline ...
-
bioRxiv - Molecular Biology 2020Quote: ... rabbit anti-V5 (GenScript, 1:500 dilution), rabbit anti-HA (Cell Signaling ...
-
bioRxiv - Biochemistry 2020Quote: 2 µg GST (GenScript; Cat. # Z02039-1), ubiquitin (R&D Systems ...
-
bioRxiv - Developmental Biology 2020Quote: ... rabbit anti-Blimp1 (1:1000, GenScript, A01647). Retinas were washed PBS ...
-
bioRxiv - Biochemistry 2021Quote: ... The cDNAs of GALNTs 1-20 (Genscript) were amplified by PCR and digested by BamHI and NotI (GALNT1 ...
-
Recruitment of MRE-11 to complex DNA damage is modulated by meiosis-specific chromosome organizationbioRxiv - Genetics 2020Quote: ... rabbit anti-OLLAS (1:1,000; Genscript #A01658), goat anti-SYP-1 (1:500) ...
-
bioRxiv - Developmental Biology 2020Quote: ... rabbit polyclonal anti OLLAS (Genscript, 1:1500), rabbit polyclonal anti PAR (Trevigen ...
-
bioRxiv - Microbiology 2020Quote: ... 1:250 (GenScript, catalog no. A01658-40), mouse anti-HA 1:500 (BioLegend ...
-
bioRxiv - Microbiology 2021Quote: ... and anti-RFP (1:3000 dilution, GenScript), anti-Dpm1 (1:3,000 dilution ...
-
bioRxiv - Biophysics 2022Quote: Isoform 1 of human SERINC2 (GenScript-OHu23082D) was cloned into pFastBacI with the TEV and STREP cleavage and affinity tags upstream of the gene encoding hSERINC2 ...
-
bioRxiv - Immunology 2022Quote: ... or rabbit (GenScript, A00098, 1:2,000 diluted) IgG was added and then developed with 3,3’,5,5’ -tetramethylbenzidine (TMB ...
-
bioRxiv - Microbiology 2023Quote: ... rabbit polyclonal anti-BiP (1:600, GenScript) serum ...
-
bioRxiv - Neuroscience 2023Quote: ... which was bought from GenScript (Table 1).
-
bioRxiv - Neuroscience 2023Quote: ... Tat-beclin 1 (YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT) (7.5 µg, Genscript) or tat-scrambled (YGRKKRRQRRRGGVGNDFFINHETTGFATEW ...
-
bioRxiv - Immunology 2023Quote: ... Streptavidin-HRP (GenScript, M00091; 1:5000 dilution) was added to the wells and incubated at 37°C for 1hr ...
-
bioRxiv - Biochemistry 2024Quote: ... 1 mg/mL 3X-FLAG peptide (Genscript). Final purification was achieved by size exclusion chromatography (SEC ...
-
bioRxiv - Cell Biology 2024Quote: ... rabbit anti-pS1133WRN (Genscript-custom, 1:10000); rabbit anti-GST (Calbiochem ...
-
bioRxiv - Molecular Biology 2023Quote: ... and Anti-LmGAPDH (dilution 1:2,000 - GenScript), followed by incubation with Anti-rabbit IgG (dilution 1:50,000 - BioRad ...
-
bioRxiv - Biochemistry 2022Quote: ... and goat anti-Sch9 (GenScript, 1:1’000). To assess the loading ...
-
bioRxiv - Developmental Biology 2022Quote: ... rabbit anti-OLLAS 1:1000 (Genscript, A01658)) were added and incubated overnight in a humid chamber with a parafilm cover ...
-
bioRxiv - Cell Biology 2024Quote: ... anti-GST-HRP (A01380, Genscript, 1:500), anti-GAPDH-HRP (HRP-60004 ...
-
bioRxiv - Plant Biology 2024Quote: ... at 1:5000 and anti-pT78 (GenScript) at 1:4000 ...
-
bioRxiv - Biochemistry 2024Quote: ... 1 mg/mL synthetic HA peptide (GenScript), pH 7.4] that were incubated on-column for 5 minutes at room temperature before collecting eluates in 1.5 mL microcentrifuge tubes ...
-
bioRxiv - Molecular Biology 2024Quote: ... ASOs were synthesized by GenScript (Table 1) with phosphorothioate backbones and 2’-O-methyl modifications on every base ...
-
bioRxiv - Cancer Biology 2024Quote: ... 2 million cells/well were added into a 6-well plate and cultured with 2 mL RPMI-1640 medium/well (10 ng/mL IL-4, and 20 ng/mL mGM-CSF, GenScript, China) to obtain BMDCs at 37°C with 5% CO2 ...
-
bioRxiv - Neuroscience 2024Quote: ... and the tracrRNA were injected with 200 ng/µl of recombinant Cas9 protein (Integrated DNA Technologies) and 10 ng/µl of a single-stranded DNA template (Megamer® single-stranded DNA fragment, GenScript) into the pronucleus of B6D2F2 zygotes which were subsequently transferred to pseudopregnant CD1 mice ...
-
bioRxiv - Developmental Biology 2024Quote: ... Heparin sulfate beads (100-150 µm in diameter) were pre-soaked in 10 µL of 100 µg/mL FGF10 (GenScript, Z03155). After Matrigel (80% ...
-
bioRxiv - Molecular Biology 2024Quote: ... mouse anti-Strep-tag (IBA, 2-1507-001, 1:1,000) rabbit anti-CBP-tag (GenScript, A00635-40, 1:1,000), mouse anti-V5-tag (Proteintech Group ...
-
bioRxiv - Genetics 2023Quote: ... mutans cultures were diluted 1:40 from overnight cultures and grown to an optical density of OD600 ∼0.1 in THYE before the addition of transforming DNA and 1 μg ml−1 Competence Stimulating Peptide (CSP; GenScript). The cultures were subsequently incubated for an additional 2 h and then plated on antibiotic-supplemented THYE plates ...
-
bioRxiv - Cell Biology 2020Quote: ... S100 supernatant was added directly to 600 μL of basic lysis buffer with protease inhibitors and NEM containing 30 μL 1:1 anti FLAG Affinity Gel (Genscript). All samples were incubated overnight at 4°C ...
-
bioRxiv - Biochemistry 2022Quote: The N-terminal peptides of ParBpSM (residues 1-27) and ParBP1 (residues 1-30) used in the ATPase assays were synthesized by GenScript. The sequence of ParBpSM1-27 and its variant ParBpSM1-27 K10A were NH2-MIVGNLGAQKAKRNDTPISAKKDIMGD-CO2H (≥97 % purity ...
-
bioRxiv - Molecular Biology 2022Quote: ... The coding sequences of human UBXN1 (Uniprot identifier Q04323-1) and FAF2 (Uniprot identifier Q96CS3-1) were synthesized by GenScript Biotech ...