Labshake search
Citations for GenScript :
201 - 250 of 697 citations for Pregnanediol 3 Glucuronide PDG ELISA Kit 1 Plate since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2021Quote: ... 1 μM CabTRP Ia (GenScript, Piscataway, NJ) was added to the saline ...
-
bioRxiv - Molecular Biology 2020Quote: ... rabbit anti-V5 (GenScript, 1:500 dilution), rabbit anti-HA (Cell Signaling ...
-
bioRxiv - Biochemistry 2020Quote: 2 µg GST (GenScript; Cat. # Z02039-1), ubiquitin (R&D Systems ...
-
bioRxiv - Developmental Biology 2020Quote: ... rabbit anti-Blimp1 (1:1000, GenScript, A01647). Retinas were washed PBS ...
-
bioRxiv - Biochemistry 2021Quote: ... The cDNAs of GALNTs 1-20 (Genscript) were amplified by PCR and digested by BamHI and NotI (GALNT1 ...
-
Recruitment of MRE-11 to complex DNA damage is modulated by meiosis-specific chromosome organizationbioRxiv - Genetics 2020Quote: ... rabbit anti-OLLAS (1:1,000; Genscript #A01658), goat anti-SYP-1 (1:500) ...
-
bioRxiv - Developmental Biology 2020Quote: ... rabbit polyclonal anti OLLAS (Genscript, 1:1500), rabbit polyclonal anti PAR (Trevigen ...
-
bioRxiv - Microbiology 2020Quote: ... 1:250 (GenScript, catalog no. A01658-40), mouse anti-HA 1:500 (BioLegend ...
-
bioRxiv - Microbiology 2021Quote: ... and anti-RFP (1:3000 dilution, GenScript), anti-Dpm1 (1:3,000 dilution ...
-
bioRxiv - Biochemistry 2022Quote: ... and goat anti-Sch9 (GenScript, 1:1’000). To assess the loading ...
-
bioRxiv - Developmental Biology 2022Quote: ... rabbit anti-OLLAS 1:1000 (Genscript, A01658)) were added and incubated overnight in a humid chamber with a parafilm cover ...
-
bioRxiv - Biophysics 2022Quote: Isoform 1 of human SERINC2 (GenScript-OHu23082D) was cloned into pFastBacI with the TEV and STREP cleavage and affinity tags upstream of the gene encoding hSERINC2 ...
-
bioRxiv - Molecular Biology 2023Quote: ... and 10 μM ET-1/ IRL1620 (GenScript) for 1.5 h at room temperature (RT) ...
-
bioRxiv - Immunology 2022Quote: ... or rabbit (GenScript, A00098, 1:2,000 diluted) IgG was added and then developed with 3,3’,5,5’ -tetramethylbenzidine (TMB ...
-
bioRxiv - Neuroscience 2023Quote: ... which was bought from GenScript (Table 1).
-
bioRxiv - Microbiology 2023Quote: ... rabbit polyclonal anti-BiP (1:600, GenScript) serum ...
-
bioRxiv - Immunology 2023Quote: ... Streptavidin-HRP (GenScript, M00091; 1:5000 dilution) was added to the wells and incubated at 37°C for 1hr ...
-
bioRxiv - Neuroscience 2023Quote: ... Tat-beclin 1 (YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT) (7.5 µg, Genscript) or tat-scrambled (YGRKKRRQRRRGGVGNDFFINHETTGFATEW ...
-
bioRxiv - Molecular Biology 2023Quote: ... and Anti-LmGAPDH (dilution 1:2,000 - GenScript), followed by incubation with Anti-rabbit IgG (dilution 1:50,000 - BioRad ...
-
bioRxiv - Plant Biology 2024Quote: ... 1 unit of Taq DNA polymerase (GenScript). PCR was conducted at 94 °C for 3 min for denaturation followed by 35-40 cycles of 94 °C for 30 sec ...
-
bioRxiv - Biochemistry 2024Quote: ... 1 mg/mL 3X-FLAG peptide (Genscript). Final purification was achieved by size exclusion chromatography (SEC ...
-
bioRxiv - Cell Biology 2024Quote: ... rabbit anti-pS1133WRN (Genscript-custom, 1:10000); rabbit anti-GST (Calbiochem ...
-
bioRxiv - Genetics 2023Quote: ... mutans cultures were diluted 1:40 from overnight cultures and grown to an optical density of OD600 ∼0.1 in THYE before the addition of transforming DNA and 1 μg ml−1 Competence Stimulating Peptide (CSP; GenScript). The cultures were subsequently incubated for an additional 2 h and then plated on antibiotic-supplemented THYE plates ...
-
bioRxiv - Molecular Biology 2024Quote: ... mouse anti-Strep-tag (IBA, 2-1507-001, 1:1,000) rabbit anti-CBP-tag (GenScript, A00635-40, 1:1,000), mouse anti-V5-tag (Proteintech Group ...
-
bioRxiv - Microbiology 2020Quote: ... The remnant endotoxin was identified with ToxinSensorTM Chromogenic LAL Endotoxin Assay Kit (Genscript) and no more than 0.1 EU/mL of endotoxin was detected.
-
bioRxiv - Microbiology 2020Quote: Endotoxin of all purified proteins was removed with ToxinEraserTM Endotoxin Removal Kit (Genscript) in accordance to the manufacturer’s instruction ...
-
bioRxiv - Microbiology 2021Quote: The SARS-CoV-2 Surrogate Virus Neutralization Test Kit from GenScript (REF: L00847) was used according to manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2019Quote: ... quantified using a chromogenic limulus amebocyte lysate endotoxin assay kit (GenScript, Piscataway, NJ), were significantly below those necessary for activation of TLR4 (typically <0.05 ng/ml).
-
Development of monoclonal antibody-based blocking ELISA for detecting SARS-CoV-2 exposure in animalsbioRxiv - Microbiology 2023Quote: ... A cPass™ SARS-CoV-2 Neutralization Antibody Detection Kit (GenScript, Piscataway, NJ) was used and the test was performed following the instructions of the manufacture ...
-
bioRxiv - Immunology 2023Quote: ... Endotoxin levels were measured using the ToxinSensor Chromogenic LAL Endotoxin Assay Kit (Genscript), according to the manufacturer’s instructions ...
-
bioRxiv - Synthetic Biology 2023Quote: ... Some recombinants were generated by homologous recombination using GenBuilder Kit (GenScript Biotech Corporation) following manufacturer’s instructions.
-
bioRxiv - Cell Biology 2020Quote: ... S100 supernatant was added directly to 600 μL of basic lysis buffer with protease inhibitors and NEM containing 30 μL 1:1 anti FLAG Affinity Gel (Genscript). All samples were incubated overnight at 4°C ...
-
bioRxiv - Biochemistry 2022Quote: The N-terminal peptides of ParBpSM (residues 1-27) and ParBP1 (residues 1-30) used in the ATPase assays were synthesized by GenScript. The sequence of ParBpSM1-27 and its variant ParBpSM1-27 K10A were NH2-MIVGNLGAQKAKRNDTPISAKKDIMGD-CO2H (≥97 % purity ...
-
bioRxiv - Molecular Biology 2022Quote: ... The coding sequences of human UBXN1 (Uniprot identifier Q04323-1) and FAF2 (Uniprot identifier Q96CS3-1) were synthesized by GenScript Biotech ...
-
bioRxiv - Immunology 2022Quote: ... et al (HPV16 E7) and Drakes et al (NY-ESO-1, 1G4 and MART-1, DMF5) were ordered from GenScript in the MSGV-retroviral vector (33 ...
-
bioRxiv - Immunology 2020Quote: The SARS-CoV-2 pseudovirus was produced by co-transfection of HEK293T cells with 1:1 ratio of DNA plasmid encoding SARS-CoV-2 S protein (GenScript) and backbone plasmid pNL4-3.Luc.R-E-(NIH AIDS Reagent ...
-
bioRxiv - Molecular Biology 2022Quote: ... The genes for the designed HN protein variant 1 (HNv1) and F protein variant 1 (Fv1) were codon-optimized for expression in SJ and synthesized by Genscript® ...
-
bioRxiv - Developmental Biology 2022Quote: ... The blot was incubated with 10 μg/mL pre-biotin-CpOGACD for 1 h at room temperature followed by incubation with streptavidin-HRP (1:5000, M00091, GenScript) for 30 min.
-
bioRxiv - Cell Biology 2023Quote: ... residues 1-77) and human STX4 (lacking the transmembrane domain; residues 1-271 with 272C) were generated as synthetic genes (Genscript) with codon optimization for human expression ...
-
bioRxiv - Immunology 2023Quote: ... DNA encoding HLA-C*05:01 (1-278) and β2M (1-99) were synthesized and cloned into pET30a by Genscript and were previously described42 ...
-
bioRxiv - Immunology 2023Quote: Genes coding for SARS-CoV-2 Spike (S) ectodomains (Hu-1 and BA.1) with Hisx8 and Strep tags were synthesized by Genscript and cloned into the pcDNA3.1(+ ...
-
bioRxiv - Biophysics 2023Quote: The C-terminal 10mer peptides of nectin-1 and JAM-A (sequences in Supplementary Table 1) were purchased lyophilized from Genscript with N-terminal biotinylation and N-terminal FITC conjugation ...
-
bioRxiv - Microbiology 2023Quote: Genes encoding His-tagged ectodomain versions of the HSV-1 gD receptors HVEM (HVEM200t) or nectin-1 (nectin345t) were synthesized by GenScript (GenBank accession numbers AF060231 and U70321 ...
-
bioRxiv - Molecular Biology 2024Quote: ... or LV1-eGFP-miR-7 were generated by subcloning inserts from pAAV_hSYN1-eGFP-miR-7 and pAAV_hSYN1-eGFP (provided by Thomas B. Hansen) inside LV1 (immunodeficiency virus 1 (HIV-1)-based LV-PGK-GFP) backbone by GenScript Biotech Corporation ...
-
bioRxiv - Developmental Biology 2021Quote: ... and guinea pig anti-Runt (1:600; GenScript). Rhodamine-phalloidin (Invitrogen R415 ...
-
bioRxiv - Developmental Biology 2021Quote: Anti-ApoB-1 antibodies were generated by GenScript USA (Piscataway ...
-
bioRxiv - Biochemistry 2020Quote: Glutathione S-Transferase (GST) (GenScript; Cat. # Z02039-1), ubiquitin (R&D Systems ...
-
bioRxiv - Microbiology 2019Quote: ... and incubated with 500 pM GLP-1 (GenScript) for 4 h at room temperature ...
-
bioRxiv - Immunology 2021Quote: ... and 1 mg/mL MOG35-55 peptide (Genscript). Mice were immunized on both flanks by subcutaneous injection of the emulsion for a total of 200 µL ...
-
bioRxiv - Cell Biology 2021Quote: ... Mouse anti-Tubulin antibody (1:10000, A01410, GenScript), rabbit anti-LaminB1 (1:5000 ...