Labshake search
Citations for GenScript :
51 - 100 of 853 citations for Recombinant Human IL6 Protein non tagged Biotinylated since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2023Quote: ... Recombinant BRD4 N-terminal protein was purchased from GenScript (BRD4-N (49-460aa), His ...
-
bioRxiv - Microbiology 2020Quote: ... 60 or 100 nM of his/FLAG-tagged SARS-CoV-2 spike protein (GenScript, Z03481-100) was added to each well ...
-
bioRxiv - Cell Biology 2022Quote: M1 ubiquitinated proteins were enriched using GST-tagged UBAN-coupled Glutathione MagBeads (Genscript, Piscataway NJ, SA), as described previously 116 ...
-
bioRxiv - Microbiology 2023Quote: ... were generated via gene synthesis and cloned to produce 6xHis-tagged proteins by Genscript (Piscataway, NJ). Briefly ...
-
bioRxiv - Immunology 2021Quote: ... human recombinant IL-2 (10 U/well) and with or without NP311 or NP366 peptides (Genscript) at 0.2ug/ml ...
-
bioRxiv - Microbiology 2023Quote: The full recombinant MPL36 protein (rMPL36/aa 41-321) was commercially produced by GenScript® Biotech with His-tag in an E ...
-
bioRxiv - Microbiology 2023Quote: ... and biotinylated peptide (GenScript) stock powders were dissolved in DMSO and diluted with PBST ...
-
bioRxiv - Cell Biology 2021Quote: ... The anti-Mps1 antibodies were generated in rabbits against a recombinant Mps1 protein fragment (residues 440-764) of the protein by Genscript. The company provided affinity purified antibodies that we validated by purifying kinetochores from yeast strains with Mps1 or Mps1-13Myc and confirming that the antibody recognized a protein of the correct molecular weight that migrated more slowly with the 13Myc epitope tags ...
-
bioRxiv - Biophysics 2023Quote: ... The anti-Scm3 antibodies were generated in rabbits against a recombinant Scm3 protein fragment (residues 1-28) of the protein by Genscript. The company provided affinity-purified antibodies that we validated by immunoprecipitating Scm3 from yeast strains with Scm3-V5 and confirming that the antibody recognized a protein of the correct molecular weight that was also recognized by α-V5 antibody (Invitrogen ...
-
bioRxiv - Biochemistry 2022Quote: The C-terminally His-tagged construct encoding human UGGT1 residues 43-1551 was PCR-amplified from the commercially sourced vector UGGT1-pUC57 (GenScript) with primers ...
-
bioRxiv - Molecular Biology 2021Quote: ... and Human CLEC16A C-terminal Flag epitope-tagged full-length or alternatively spliced disease isoform vectors (Genscript; OHu18264D and OHu02258D). Constructs containing CLEC16A ΔC (1-892 only ...
-
bioRxiv - Biophysics 2019Quote: ... FLAG-tagged hZP3 and HA-tagged hZP4 were synthesized (GenScript; GeneArt/Thermo Fisher Scientific) and subcloned into pHLsec329 ...
-
bioRxiv - Biochemistry 2024Quote: ... His-tagged Enterokinase (Z03004, Genscript) was added to the dialyzed ...
-
bioRxiv - Bioengineering 2022Quote: ... Protein sequences were human codon-optimized using online tools (GenScript), synthesized as gene blocks (IDT) ...
-
bioRxiv - Microbiology 2023Quote: ... enterica Tsr LBD construct for recombinant protein expression was performed as a service by Genscript Biotech Corp ...
-
bioRxiv - Immunology 2021Quote: The cDNA of membrane glyco-protein (MGP) and Non-structure protein 13 (NSP13) of ORF1b from SARS-CoV-2 were purchased from Genscript (NJ, USA) and cloned into lentiviral vector pLVX (TAKARA ...
-
bioRxiv - Immunology 2021Quote: The cDNA of membrane glyco-protein (MGP) and Non-structure protein 13 (NSP13) of ORF1b from SARS-CoV-2 were purchased from Genscript (NJ, USA) and cloned into lentiviral vector pLVX (TAKARA ...
-
bioRxiv - Molecular Biology 2022Quote: Biotinylated peptides (synthetised by Genscript) were resuspended in DMSO ...
-
bioRxiv - Molecular Biology 2023Quote: ... casΦ-2 of Biggiephage (22), a short, non-CIS related AMPs, human ll-37 (Uniprot: P49913, ‘[LL-37, 37 aa]’) afp18ΔC8 from Genscript. The two non-CIS cargos ll-37 and casΦ-2 were cloned into the designed afp18 N-terminal constructs including the first 50 ...
-
bioRxiv - Molecular Biology 2023Quote: ... A custom RHINO polyclonal antibody was outsourced from GenScript using the recombinant protein described in the “Protein purification section” with 6xHIS tag retained and produced in rabbit (GenScript; 1:1000 dilution). The secondary antibodies were mouse IgG HRP-linked (NA931 ...
-
bioRxiv - Microbiology 2021Quote: ... Production of FLAG-tagged transporter proteins was assessed by western blotting using anti-FLAG antibody (Genscript, Piscataway, NJ, USA) as described previously (5).
-
bioRxiv - Immunology 2022Quote: ... B2 F and hMPV B2F-GCN4 recombinant proteins were synthesized from the plasmids obtained from GenScript cloned into pcDNA3.1+ vector ...
-
bioRxiv - Neuroscience 2024Quote: ... GO grids were first incubated with 3 µL of 250 nM recombinant protein G (Genscript Z02007) in resuspension buffer ...
-
bioRxiv - Microbiology 2023Quote: Recombinant bacmids and recombinant baculovirus stocks were produced by GenScript. The high-titer P2 was used to make P3 baculovirus for a large-scale expression ...
-
bioRxiv - Molecular Biology 2021Quote: ... The purified FLAG-tagged proteins were cleaved from MBP or Glutathione S-transferase (GST) using 3C protease (Genscript #Z03092-100) and their purity was analyzed by SDS-PAGE.
-
bioRxiv - Biochemistry 2021Quote: ... gene was codon-optimized and cloned into the p423_GAL1 yeast expression vector as an N-terminal Flag (DYKDDDDK) and C-terminal decahistidine (10X His) tagged fusion protein (GenScript) (Fig ...
-
bioRxiv - Biochemistry 2024Quote: ... gene was codon-optimized and cloned into the p423_GAL1 yeast expression vector as an N-terminal Flag (DYKDDDDK) and C-terminal deca-histidine (10X His) tagged fusion protein (GenScript) (Supplementary Fig ...
-
bioRxiv - Microbiology 2020Quote: ... The recombinant proteins were subjected to SDS-PAGE followed by immunoblotting using anti-HAT-tag antibody (GenScript) and HRP-conjugated anti-rabbit IgG (Jackson ImmunoResearch) ...
-
bioRxiv - Bioengineering 2022Quote: ... and biotinylated anti-STII (5A9F9, Genscript), followed by SAv-DyLight488 ...
-
bioRxiv - Cell Biology 2022Quote: ... The primary antibody against Ft-L was made using recombinant human Ft-L subunit as antigen by GenScript (Nanjing, China).
-
bioRxiv - Biochemistry 2022Quote: Substrate phosphorylation time course assays with PKD1ULD-5G/10G-KD were performed on ice with 50 nM protein and 100 µM biotinylated Syntide2 (biotin-PLARTSVAG (GenScript)) ...
-
bioRxiv - Biochemistry 2023Quote: ... pcDNA3.1 expressing strep-Myc-tagged ubiquitin (Genscript) was used.
-
bioRxiv - Biochemistry 2021Quote: ... FLAG-tagged proteins were released from the resin by incubation with buffer supplemented with 50 mM FLAG peptide (Genscript, Piscataway, NJ) for 30 min.
-
bioRxiv - Biochemistry 2020Quote: ... Recombinant protein was eluted using 20 column columns purification buffer supplemented with 1 μM DYKDDDDK FLAG peptide (Genscript). Affinity purification of the TSEN-STREP construct was carried out using the STREP tag carried by the TSEN2 subunit ...
-
bioRxiv - Microbiology 2021Quote: Plasmid constructs to produce recombinant proteins were made with a combination of synthesized DNA fragments (GenScript Biotech, Netherlands) and PCR amplicons using extracted culture gDNA as a template ...
-
bioRxiv - Immunology 2021Quote: A 96-well plate was coated overnight at 4ºC with 100 µL of a recombinant human ACE-2 fused to a Fc fragment (GenScript Laboratories, USA) at 1 µg/mL in carbonate buffer (pH 9.6) ...
-
bioRxiv - Cell Biology 2023Quote: ... The plasmids expressing human KLF family proteins were purchased from Genscript (Piscataway, NJ) or OriGene (Rockville ...
-
bioRxiv - Immunology 2021Quote: ... biotinylated detection antibody (GenScript, Cat# 5E10G8-Biotin) was added at 1 µg/mL final concentration in blocking buffer and plate was incubated at room temperature for 1 hour ...
-
bioRxiv - Cell Biology 2022Quote: Pulldown with N-terminally biotinylated peptides (GenScript) was carried out as follows ...
-
bioRxiv - Bioengineering 2023Quote: ... or non-degradable (KKCGGDQGIAGFGCKK, Genscript). The value of thiol group ...
-
bioRxiv - Bioengineering 2024Quote: ... or non-degradable (KKCGGDQGIAGFGCKK, Genscript). HA hydrogels had a total peptide crosslinker concentration of 0.838 mM for H80 ...
-
bioRxiv - Cancer Biology 2021Quote: Codon-optimized cDNAs encoding N-terminal HA or Flag-tagged WT PEAK3 and HA-tagged PEAK3 mutants were synthesized by Genscript and cloned into the EcoRI restriction sites of the pMIG-GFP Express vector.
-
bioRxiv - Molecular Biology 2022Quote: ... HeLa FJ-KO cells were transfected with the following plasmids: pMK204-TetOne AAVS1-MCS (+) Flag-tagged FANCJ WT or pMK240-TetOne AAVS1-MCS (+) Flag-tagged FANCJ-AALA (GenScript). The plasmid pMK240-TetOne AAVS1-MCS (+) ...
-
bioRxiv - Biochemistry 2023Quote: ... N-terminal MBP-His6-tagged) and AblFL (residues 64-510, TEV-cleavable, N-terminal MBP-His6-tagged) was synthesized and cloned by GenScript into pETm41 (Fig ...
-
bioRxiv - Biochemistry 2020Quote: ... Recombinant SARS-CoV-1 spike protein was obtained from SinoBiological and SARS-CoV-2 spike was obtained from Genscript and Acro Biosystems.
-
bioRxiv - Immunology 2021Quote: The following reagents were used in the study: recombinant SARS-CoV-2 spike S1 protein (GenScript Cat. No. Z03501), TLR9 agonists CpG-ODN 1826 (Invivogen ...
-
bioRxiv - Microbiology 2021Quote: ... N-terminus biotinylated peptides were synthesized by Genscript. N-terminal GSGS linker sequence was added to all peptide sequences ...
-
bioRxiv - Biochemistry 2023Quote: N-terminal biotinylated peptides were synthesized by Genscript at ≥95% purity and dissolved in 100% DMSO to a stock concentration of 10 µg/µL ...
-
bioRxiv - Immunology 2021Quote: ... This recombinant target panel consisted of two full-length viral structural proteins, S (FL, trimer-stabilized, LakePharma) and N (GenScript); two truncated S protein domains ...
-
bioRxiv - Developmental Biology 2022Quote: ... a Flag-tagged FGF8b clone was obtained from Genscript CloneID ...