Labshake search
Citations for GenScript :
51 - 100 of 296 citations for Octreotide acetate impurity C since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biophysics 2023Quote: A Gly-Gly-Gly-Cys peptide with C-terminal amidation (Genscript) was dissolved at 173 mM in degassed coupling buffer (50 mM HEPES (pH 7.4) ...
-
bioRxiv - Neuroscience 2022Quote: ... or pLenti-TDP-43ΔNLS/2KQL-C-mGFP (Origene, mutations by GenScript). Cells were seeded onto coverslips in 24-well plates at a density of 25,000 cells/well and incubated for 24 h ...
-
bioRxiv - Biochemistry 2023Quote: ... human ARL15 (NM_019087.3) in the pcDNA3.1+/C-(K)-DYK vector (GenScript) was used and further employed to introduce the mutations into the construct ...
-
bioRxiv - Cancer Biology 2024Quote: ... pcDNA3.1+/C-(K)-DYK-AT20 (pATP5⍺-AT20) were generated by GenScript Inc ...
-
bioRxiv - Immunology 2021Quote: ... To monitor V2 responses cyclized C.1086 V2 (cV2, synthesized by GenScript) 157CSFNATTELKDKKHKVHALFYKLDVVPLNGNSSSSGEYRLINC196 was used at 1μg/ml in PBS for coating ...
-
bioRxiv - Biochemistry 2021Quote: ... and pcDNA 3.1+/C-(K)-DYK empty vector were obtained from GenScript Biotech (GenScript ...
-
bioRxiv - Molecular Biology 2020Quote: ... The pCCL-WSB1 and pCCL-c-Myc plasmids were purchased from Genscript, and were re-constructed to pCDH vector with N-terminal FLAG tag ...
-
bioRxiv - Microbiology 2022Quote: ... and pangolin) with a C-terminal V5 tag were synthesized by GenScript as described previously 42 ...
-
bioRxiv - Microbiology 2024Quote: ... RBP-coding DNA was cloned into a pcDNA3.1-C-HisTag vector (Genscript). For paramyxoviruses ...
-
bioRxiv - Microbiology 2024Quote: ... were removed using C-terminal truncations or internal deletions conducted by GenScript. For in vitro biochemical characterization ...
-
bioRxiv - Molecular Biology 2022Quote: ... Sepharose beads were then eluted with 0.5 mg/ml c-Myc peptide (Genscript) in TBS ...
-
bioRxiv - Neuroscience 2021Quote: TMEM106B C-terminal fragment (120 – 274) incorporated in pET3A was purchased from Genscript™ ...
-
bioRxiv - Molecular Biology 2020Quote: ... blocked with 5% milk and probed with C-Myc antibody (Genscript A00173-100), Rad53 antibody (Abcam ab104232) ...
-
bioRxiv - Biochemistry 2021Quote: LD membrane protein cDNAs in pcDNA3.1+/C-(k)DYK were purchased from GenScript and their variants with the OPG2 tag ...
-
bioRxiv - Biophysics 2024Quote: The mPRD2 construct with a C-terminal His-tag was bought from Genscript Inc ...
-
bioRxiv - Biochemistry 2024Quote: ... hAPN with a C-terminal Flag tag was cloned into pcDNA3.1+ by GenScript. HEK293T cells seeded at 16E6 cells in 100 mm dishes coated with poly-D-Lysine and incubated overnight at 37 °C with 5% CO2 ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... all with a C-terminus FLAG tag epitope (all from Genscript, Piscataway, NJ). Transfections were performed using Lipofectamine 2000 (ThermoFisher Scientific ...
-
bioRxiv - Microbiology 2024Quote: ... Cells were probed overnight at 4°C for SEOV N protein (custom, Genscript) at dilution 1:400 in 1xPBS and with secondary antibody AlexaFluor 555 goat α mouse (Thermo Fisher Scientific ...
-
bioRxiv - Microbiology 2024Quote: ... Cells were probed overnight at 4°C for SEOV N protein (custom, Genscript) at dilution 1:400 in 1xPBS and with secondary antibody AlexaFluor 555 goat α mouse (Thermo Fisher Scientific ...
-
bioRxiv - Biophysics 2024Quote: Purification of recombinant mouse cMyBP-C was accomplished using plasmids obtained from GenScript© and VectorBuilder© that were codon optimized for expression in bacteria ...
-
bioRxiv - Biochemistry 2020Quote: ... faecalis (UniProtKB-Q07448) and with a C-terminal His6-tag were synthesized by GenScript and cloned into the the pET11a vector ...
-
bioRxiv - Bioengineering 2021Quote: ... pcDNA3.1+C-eGFP plasmid and plasmid encoding Cas9 and sgRNA were purchased from GenScript® ...
-
bioRxiv - Systems Biology 2021Quote: ... cell were stained overnight at 4°C with SARS-CoV-2 N-antibody (Genscript) at a dilution of 1:500 in PBS + 1% BSA+ 1%FBS ...
-
bioRxiv - Molecular Biology 2022Quote: ... Sam68 C-terminal cDNA was synthetized with optimized codon composition for bacterial expression (Genscript).
-
bioRxiv - Developmental Biology 2020Quote: ... Full-length mRNA constructs in pcDNA3.1+/C-(K)DYK vectors were obtained from GenScript Biotech (Piscataway ...
-
bioRxiv - Microbiology 2023Quote: Synthetic peptides of P covering the sequence N-EDDIYQLIM-C were obtained from GenScript. The peptide was dissolved in deionised water dosed with a drop of 5 M NH4OH to improve solubility ...
-
bioRxiv - Microbiology 2023Quote: ... Full-length and C-terminal constructs were purified by Ni-IDA affinity chromatography (GenScript) as per the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2023Quote: ... pcDNA3.1-C-FLAG containing human ATP6V1H transcript variant 1 (NM_015941.4) was purchased commercially (GenScript). pcDNA3.1-ATP6V1H(1-351)-FLAG ...
-
bioRxiv - Cancer Biology 2024Quote: ... oeANXA4: Human ANXA4 (NM_001320698.2) in pcDNA3.1+/C-(K)-DYK vector was purchased from GenScript (GenScript Biotech ...
-
bioRxiv - Biophysics 2020Quote: The GroES mobile loops3 ETKSAGGIVLTGS and GroEL C-tails (GGM)4M were ordered from Genscript. GroES mobile loops and C-tails were dissolved in MQ water and snap frozen using liquid nitrogen ...
-
bioRxiv - Biochemistry 2021Quote: ... The C-terminal TwinStrep-HA tag (sequence TGGGGSGGGASWSHPQFEKGGSGGGSWSH PQFEKGGYPYDVPDYA*) was synthetized and cloned (by Genscript) between the EcoRI and BamHI sites of the pLVX-TetOne-Puro vector (631849 ...
-
bioRxiv - Biochemistry 2021Quote: A peptide corresponding to the C-terminal 28aa of Nbs1 (Nc28) was purchased from Genscript and dissolved in 100mM HEPES pH 7.4 to a concentration of 2mM as measured by 205nm absorbance ...
-
bioRxiv - Cancer Biology 2022Quote: ... and the pcDNA3.1+-C-(K)-DYK plasmid expressing Flag-EBP was purchased from GenScript (#OHu18817). Primers for site-directed mutagenesis of the EBP gene were designed using the QuikChange Primer Design Program (https://www.agilent.com/store/primerDesignProgram.jsp?_requestid=1072141 ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: Human C-type natriuretic peptide (CNP) and rat atrial natriuretic peptide (ANP) were from GenScript Corp ...
-
bioRxiv - Cancer Biology 2024Quote: ... and TTK genes were introduced in PANC-1 using pcDNA3.1+/C-(K)-DYK (GenEZ; GenScript) vectors (10 µg/ml) ...
-
bioRxiv - Immunology 2024Quote: All constructs contained a C-terminal histidine affinity tag and were codon optimized by GenScript for mammalian cell expression ...
-
bioRxiv - Immunology 2022Quote: ... was incubated with the substrate of ssDNA (ssBiotin 26nt Me-C Oligo 30 nM, Genscript), in the presence of aKG (115 μM ...
-
bioRxiv - Immunology 2022Quote: ... was incubated with the substrate of ssDNA (ssBiotin 26nt Me-C Oligo 30 nM, Genscript), in the presence of αKG (115 μM ...
-
bioRxiv - Cell Biology 2024Quote: Tg-FLAG in pcDNA3.1+/C-(K)-DYK plasmid was purchased from Genscript (Clone ID OHu20241). The Tg-FLAG gene was then amplified and assembled with an empty pcDNA5/FRT expression vector using a HiFi DNA assembly kit (New England BioLabs ...
-
bioRxiv - Biochemistry 2024Quote: ... were each cloned into the vector pcDNA3.1+/C-(K)DYK backbone and purchased from GenScript USA Inc ...
-
bioRxiv - Biophysics 2024Quote: ... cDNA encoding C-terminally His6-tagged WT and truncated versions of SH Mumps (GenScript, Netherlands) in the pXOOM expression vector (55) ...
-
bioRxiv - Cancer Biology 2024Quote: ... Peptides with N terminal acetylation and C terminal amidation were purchased from Genscript (Rijswijk, Netherlands). Peptides were dissolved in DMSO ...
-
bioRxiv - Biochemistry 2020Quote: ... Human codon-optimized HSPH1 fused C-terminally to a Myc-tag was expressed from pcDNA3.1 (Genscript). cDNA encoding wild-type human ubiquitin containing an N-terminal HA-tag was expressed from pRK5-HA (Addgene) ...
-
bioRxiv - Cancer Biology 2021Quote: ... protein – NP_001058.2) cloned into pcDNA3.1+/C-(K)-DYK vector (Clone ID OHu21029D) was purchased from Genscript. The cDNAs were cloned into a bacterial expression vector ...
-
bioRxiv - Immunology 2020Quote: ... the complete open reading frame of murine HMGB1 was cloned into pcDNA3.1(+)-C-6His vector (GenScript). Transfection was performed using FectoPRO transfection reagent (Polyplus transfection) ...
-
bioRxiv - Immunology 2020Quote: ... at 95°C for 5 min and then separated using ExpressPlus PAGE Gels 4-20% (GenScript). Proteins were transferred to a polyvinylidene fluoride (PVDF ...
-
bioRxiv - Genetics 2023Quote: The expression vector for C-terminally Flag-tagged full-length human GDF15 was obtained from Genscript. The C211G mutant was generated by site-directed mutagenesis of the wild-type vector using the QuikChange II protocol (Agilent) ...
-
bioRxiv - Neuroscience 2024Quote: ... and a plasmid encoding human Kv5.1 with a C-terminal GFP tag was generated by Genscript. The Kv5.1BBS construct was generated at Genscript by inserting a bungarotoxin-binding site (GGWRYYESSLLPYPDGG ...
-
VPS13B is localized at the cis-trans Golgi complex interface and is a functional partner of FAM177A1bioRxiv - Cell Biology 2023Quote: ... FAM177A1-Halo and FAM177A1-SNAP are all cloned fromFAM177A1 pcDNA3.1+/C-(K)-DYK (GenScript Clone ID:OHu30351D) using the primers in (Table S1 ...
-
bioRxiv - Biochemistry 2022Quote: ... Fluorescein amide-labeled SSB C-terminal peptide (5-FAM WMDPDDDIPF) was synthesized and purified commercially (GenScript).