Labshake search
Citations for GenScript :
901 - 950 of 1299 citations for Human IgM Anti Dengue Virus NS1 Serotype 1 Antibody OB4 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Plant Biology 2021Quote: ... This polyclonal antibody was raised in rabbits against a synthetic peptide (CKTYLGRPWKEYSRT) (Genscript, Piscataway, NJ, USA) that includes the highly conserved amino acid sequence including residue in the catalytic site of PMEs (Markovič and Janeček ...
-
bioRxiv - Microbiology 2022Quote: ... Heavy chain variable (VH) and light chain variable (VL) genes for each antibody were synthesized (GenScript), then transfected into Expi293 cells (Thermo Fisher Scientific) ...
-
bioRxiv - Biophysics 2020Quote: ... Genes for the heavy and light chain of the CR3022 antibody were obtained from Genscript (USA) and cloned into the pcDNA3.4 vector
-
bioRxiv - Microbiology 2023Quote: ... and a rabbit polyclonal antibody against the full-length PRV VP16 that was ordered from Genscript. Anti-cJun and anti-phospho-cJun (Ser63 ...
-
bioRxiv - Cancer Biology 2023Quote: The p53-5H7B9 mouse monoclonal antibody (subclass IgG2a) was purchased from GenScript (catalog number A01767-40) as lyophilized protein in PBS ...
-
bioRxiv - Molecular Biology 2023Quote: ... Immunoprecipitations were performed using 0.5μg IgG or RBM10 antibody and protein A magnetic beads (GenScript #L00273) incubated with 2mg lysate overnight at 4°C ...
-
bioRxiv - Synthetic Biology 2023Quote: ... diluted to OD of 0.1 – 0.3 and stained with THETM iFluor 647 HA Tag antibody (GenScript; 1:500 – 1:1,000 dilution of 0.5 mg/ml stock in 10 mg/ml BSA ...
-
bioRxiv - Biophysics 2022Quote: ... Protein was eluted by incubation with 3 BVs elution buffer (wash buffer supplemented with either 3C protease (1:10 w:w 3C:ABCA7) or 0.5 mg ml-1 1D4 peptide (GenScript)) for 2-18 hours.
-
bioRxiv - Biochemistry 2021Quote: ... a SARS-CoV-2 S gene encoding residues 1-1138 (WuhanHu-1; GenBank: MN908947.3) was ordered (Genscript) and cloned into a pPPI4 plasmid containing a T4 trimerization domain followed by a hexahistidine tag by PstI-BamHI digestion and ligation ...
-
bioRxiv - Developmental Biology 2019Quote: Variant #1: a FseI-HH-gRN(#2)NA#1-HDV-HindIII fragment was de novo synthetized (Genscript). This contains a conditional gRNA#1 activatable by the gRNA#2 and flanked by the Hammerhead and HDV ribozymes (29) ...
-
bioRxiv - Biochemistry 2024Quote: ... Clarified lysate from 1 L of culture was incubated with 1 mL of equilibrated Ni-resin (Genscript) and washed with 30 mL wash buffer (50 mM Tris pH 7.5 ...
-
bioRxiv - Microbiology 2022Quote: ... Membranes were probed with an anti-AppY antiserum (GenScript - 4.4:10000), or a Flag antibody (SIGMA - 1:10000 ...
-
bioRxiv - Biophysics 2019Quote: ... The supernatant was incubated with anti-Flag G1 affinity resin (Genscript) at 4 °C for 2 h and then washed with 30 bed volumes of lysis buffer added 0.05% GDN (Anatrace) ...
-
bioRxiv - Biochemistry 2020Quote: ... Blots were developed using HRP conjugated Goat anti-mouse IgG (Genscript) and luminata crescendo (Millipore) ...
-
bioRxiv - Molecular Biology 2020Quote: Exogenous immunoprecipitation was performed by anti-Flag IP resin (L00425, GenScript) or anti-Myc magnetic beads (B26201 ...
-
bioRxiv - Immunology 2022Quote: ... Mouse anti-His tag mAb conjugated with horseradish peroxidase (GenScript: A00186) at a 1:8000 dilution was added and incubated for 30 minutes at room temperature ...
-
bioRxiv - Microbiology 2022Quote: ... An anti-SARS-2 nucleocapsid protein rabbit antiserum (generated by GenScript) was used at a 1:1000 dilution to detect specific anti–SARS-2 immunoreactivity using the Discovery ULTRA automated staining instrument (Roche Tissue Diagnostics ...
-
bioRxiv - Neuroscience 2024Quote: ... and supernatant was loaded to anti-Flag M2 affinity resin (GenScript), washed in buffer containing 25 mM HEPES pH 7.4 ...
-
bioRxiv - Immunology 2021Quote: ... Genes encoding the antibody heavy and light chains were commercially synthesized and cloned into pcDNA3.1 vector (GenScript). DNA primers for sequencing and insert amplification were ordered from IDT.
-
bioRxiv - Microbiology 2021Quote: ... CR3022 antibody heavy and light chain genes were synthesised and subcloned into pcDNA3.4 vector by Genscript (USA).
-
bioRxiv - Immunology 2023Quote: ... Genes encoding the antibody heavy and light chains were commercially synthesized and cloned into pcDNA3.1 vector (GenScript). DNA primers for sequencing and insert amplification were ordered from IDT.
-
bioRxiv - Neuroscience 2023Quote: ... # E7) in 5% non-fat milk TBST and FOLR1 antibody in 5% non-fat milk TBST (GenScript). Anti-GFP antibody or normal rabbit IgG were used as controls in FOLR1-CD2AP co-IP experiments.
-
bioRxiv - Genetics 2023Quote: Antibodies to all kinetochore proteins used in this study were custom-produced by GenScript (Piscataway, NJ, USA) or Biomatik (Cambridge ...
-
bioRxiv - Immunology 2023Quote: ... the standard curve was run using SARS-CoV-2 neutralizing antibodies (GenScript #A02055 and #BS-M0220, respectively). Sample dilution and incubation were identical to the total IgG curve ...
-
bioRxiv - Microbiology 2023Quote: ... gH was detected using custom-made polyclonal rabbit antibodies raised against peptides derived from KSHV gH (Genscript).
-
bioRxiv - Developmental Biology 2019Quote: The 5′-regulatory region of human VEGFC gene (NG_034216.1) encompassing 2274 nucleotides (−1 to −2274 in relation to ATG, Figure 1) was synthesized by GenScript. This fragment was then used as a template for deletion of either the proximal (nt −623 to −603 ...
-
bioRxiv - Cancer Biology 2023Quote: ... 1% penicillin-streptomycin) supplemented with 50 mM 2-mercaptoethanol and 1 μg/ml OVA257-264 (SIINFEKL) peptide (GenScript) at at 37 °C and 5% CO2 for 3 days ...
-
bioRxiv - Bioengineering 2023Quote: ... The synthetic peptides AM1 (theoretical Mw = 2472 g·mol-1) and SurSi (theoretical Mw = 3632 g·mol-1) were designed in our lab and synthesized by GenScript® (Nanjing ...
-
bioRxiv - Immunology 2024Quote: ... G12V-TCR alpha chain (1-206) and G12V-TCR beta chain (1-246) were synthesized by Genscript (USA) and cloned into the pET30a+ vector ...
-
bioRxiv - Neuroscience 2021Quote: ... 1 μM CabTRP Ia (GenScript, Piscataway, NJ) was added to the saline ...
-
bioRxiv - Biochemistry 2020Quote: 2 µg GST (GenScript; Cat. # Z02039-1), ubiquitin (R&D Systems ...
-
bioRxiv - Biochemistry 2021Quote: ... The cDNAs of GALNTs 1-20 (Genscript) were amplified by PCR and digested by BamHI and NotI (GALNT1 ...
-
bioRxiv - Microbiology 2020Quote: ... 1:250 (GenScript, catalog no. A01658-40), mouse anti-HA 1:500 (BioLegend ...
-
bioRxiv - Molecular Biology 2023Quote: ... and 10 μM ET-1/ IRL1620 (GenScript) for 1.5 h at room temperature (RT) ...
-
bioRxiv - Immunology 2022Quote: ... or rabbit (GenScript, A00098, 1:2,000 diluted) IgG was added and then developed with 3,3’,5,5’ -tetramethylbenzidine (TMB ...
-
bioRxiv - Neuroscience 2023Quote: ... which was bought from GenScript (Table 1).
-
bioRxiv - Immunology 2023Quote: ... Streptavidin-HRP (GenScript, M00091; 1:5000 dilution) was added to the wells and incubated at 37°C for 1hr ...
-
bioRxiv - Neuroscience 2023Quote: ... Tat-beclin 1 (YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT) (7.5 µg, Genscript) or tat-scrambled (YGRKKRRQRRRGGVGNDFFINHETTGFATEW ...
-
bioRxiv - Plant Biology 2024Quote: ... 1 unit of Taq DNA polymerase (GenScript). PCR was conducted at 94 °C for 3 min for denaturation followed by 35-40 cycles of 94 °C for 30 sec ...
-
bioRxiv - Biochemistry 2024Quote: ... 1 mg/mL 3X-FLAG peptide (Genscript). Final purification was achieved by size exclusion chromatography (SEC ...
-
bioRxiv - Genetics 2023Quote: ... mutans cultures were diluted 1:40 from overnight cultures and grown to an optical density of OD600 ∼0.1 in THYE before the addition of transforming DNA and 1 μg ml−1 Competence Stimulating Peptide (CSP; GenScript). The cultures were subsequently incubated for an additional 2 h and then plated on antibiotic-supplemented THYE plates ...
-
bioRxiv - Immunology 2021Quote: ... protein was incubated overnight at RT with anti-FLAG resin (L00432, Genscript) to remove unreacted XCL1 ...
-
bioRxiv - Biochemistry 2021Quote: ... The soluble fraction was bound to anti-DYKDDDDK resin (Genscript, Piscataway, NJ) for 1 h at 4 °C ...
-
bioRxiv - Biophysics 2020Quote: ... and the supernatant was applied to anti-Flag M2 affinity resin (GenScript) by gravity ...
-
bioRxiv - Molecular Biology 2023Quote: ... and the supernatant was loaded onto anti-DYKDDDDK G1 affinity resin (GenScript) equilibrated in buffer A ...
-
bioRxiv - Immunology 2023Quote: ... and detected with MonoRab™ Rabbit Anti-Camelid VHH Cocktail [HRP] (Genscript), diluted 1:500 in blocking buffer.
-
bioRxiv - Biochemistry 2024Quote: ... and supernatant was applied to incubate with anti-Flag affinity resin (Genscript) at 4 °C for 1.5 hours ...
-
bioRxiv - Immunology 2021Quote: ... Antibody VH or VL sequences were cloned into plasmids containing an IgG1 or relevant light chain backbone (Genscript) and used to transfect Expi293 cells (ThermoFisher Scientific) ...
-
bioRxiv - Synthetic Biology 2020Quote: ... The blots were then washed twice in TBST and incubated with horseradish peroxidase (HRP)-conjugated secondary antibody (GenScript) for 2 hours in TBST ...
-
bioRxiv - Immunology 2022Quote: ... The purified protein was used to immunize Wistar rats to generate a panel of monoclonal antibodies by Genscript USA ...