Labshake search
Citations for GenScript :
851 - 900 of 6194 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2024Quote: ... Supernatants containing expressed mAbs were collected and further purified with Protein-A magnetic beads (Genscript, L00695).
-
bioRxiv - Plant Biology 2024Quote: ... using Green Taq DNA polymerase (GenScript) with EvaGreen Dye (Biotium ...
-
bioRxiv - Synthetic Biology 2024Quote: ... and 89 were synthesized by GenScript USA Inc ...
-
bioRxiv - Synthetic Biology 2024Quote: 3x and 5x multiplex sgRNA constructs were synthesised as full-size constructs by GenScript (GenScript Biotech, UK), cut out from the delivered plasmid using BamHI ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Solid-phase peptide synthesis (SPPS) and purified macrocycle standards were generated by a commercial manufacturer (GenScript).
-
bioRxiv - Synthetic Biology 2024Quote: ... Filtrates for scFv-Fc secretions were purified using protein A resin (GenScript) as described previously30,64 ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Each gene of interest was synthesized by GenScript Biotech (Piscataway ...
-
bioRxiv - Synthetic Biology 2024Quote: ... All oligonucleotides chemically synthesized either by GenScript, USA or by Integrated DNA Technologies ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Supernatant was purified using Ni-NTA resin (GenScript) as described previously30 ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Filtrates for scFv secretions were purified using Ni-NTA resin (GenScript) as described previously30 ...
-
bioRxiv - Cancer Biology 2024Quote: ERalpha-peptide for X-ray crystallography and FAM-labeled peptides were ordered from GenScript Biotech Corp ...
-
bioRxiv - Cancer Biology 2024Quote: ... EX-02 CAR lentiviral vector (Genscript, Nanjing, China) was added at a calculated multiplicity of infection (MOI ...
-
bioRxiv - Cancer Biology 2024Quote: ... 2 million cells/well were added into a 6-well plate and cultured with 2 mL RPMI-1640 medium/well (10 ng/mL IL-4, and 20 ng/mL mGM-CSF, GenScript, China) to obtain BMDCs at 37°C with 5% CO2 ...
-
bioRxiv - Plant Biology 2024Quote: ... The estimated sequences were synthesized by Genscript Corp ...
-
bioRxiv - Microbiology 2024Quote: ... were generated via gene synthesis and cloned to produce 6xHis-tagged proteins by Genscript (Piscataway, NJ). Briefly ...
-
bioRxiv - Plant Biology 2024Quote: ... respectively (GenScript, Piscataway, NJ). SbRBCS-FLAG was subcloned under transcriptional control of the maize RBCS promoter + 5’UTR and the Panicum virgatum UBI2 (PvUBI2 ...
-
bioRxiv - Molecular Biology 2024Quote: ... competent cells were transformed with 50 ng of pGEX-4T-1-GST-TEV.TZF-WT or the TZF-NLSmut derivative which were synthesized by Genscript. The constructs contained TTP TZF domain (amino acids 93-165 ...
-
bioRxiv - Immunology 2024Quote: 15-mer peptides with 11 amino acids overlap that cover the full length of S protein of SARS-CoV-2 were synthesized (GenScript). Peptides were dissolved in DMSO at 12 mg/ml and 12-15 peptides were mixed to create 26 different semi-pools ...
-
bioRxiv - Cell Biology 2024Quote: ... and Ni-NTA beads (GenScript, China) 50 µL gel were mixed with 400 ng/μL of His-CCL5-EGFP and 44AANA47-CCL5-EGFP fusion proteins in a total volume of 500 µL ...
-
bioRxiv - Molecular Biology 2024Quote: ... a synthetic DNA template was synthesized and cloned into pUC57 vector by Genscript Biotech Corp ...
-
bioRxiv - Molecular Biology 2024Quote: Synthetic Aβ40 (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-NH2) was purchased from GenScript (Rijswijk, Netherlands). Stock solutions were prepared by dissolving 1 mg of the peptide to a final concentration of 250 μM and adding 20 mM sodium phosphate buffer ...
-
bioRxiv - Neuroscience 2024Quote: ... using the CHOPCHOP online tool (Labun et al., 2019) and pre-tested in vitro using a GenCrispr sgRNA Screening kit (Fig S3A;L00689; GenScript, NJ, USA) before insertion into vectors ...
-
bioRxiv - Bioengineering 2024Quote: ... We used gel-clot lyophilized amebocyte lysate tests (ToxinSensor, Genscript, USA) to detect the presence of endotoxin above the detection threshold ...
-
bioRxiv - Microbiology 2024Quote: ... enterica Tsr LBD construct for recombinant protein expression was performed as a service by Genscript Biotech Corp ...
-
bioRxiv - Biochemistry 2024Quote: ... and expressed in Saccharomyces cerevisiae (GenScript) strain W303.1B (hOGC and bGIC-2 ...
-
bioRxiv - Genomics 2024Quote: ... and contaminants were removed by Toxin Sensor Chromogenic LAL Endotoxin Assay Kit (GenScript, L00350). Purified proteins were concentrated and filtered using amicon ultra-filter units (MilliporeSigma ...
-
bioRxiv - Immunology 2024Quote: ... Antibody heavy chain VDJ and light chain VJ gene cassettes were synthesized (Genscript) and cloned into rhesus IgG1 (RhCMV-H) ...
-
bioRxiv - Genetics 2024Quote: ... either in house or by Genscript.
-
bioRxiv - Genetics 2024Quote: ... and bam 3’UTR by Genscript, Inc (Piscataway ...
-
bioRxiv - Cell Biology 2024Quote: ... were produced by GenScript (NM_134885.4 and NM_130731.3 ...
-
bioRxiv - Neuroscience 2024Quote: ... These mutations were synthesized commercially (GenScript, USA). The intrabodies were subcloned into pcDNA3.1 (+ ...
-
bioRxiv - Microbiology 2024Quote: ... the part of PfEMP1 encoded C-terminal to BirA* was synthesised with a different codon usage (GenScript) to prevent integration into the genome in that region and was cloned together with the targeting region (Position 2 ...
-
bioRxiv - Plant Biology 2024Quote: ... the last 1969 bp of SUF4’s disordered region was synthesized (GenScript, USA) with base pair substitutions that replaced all 30 alanine residues with isoleucine residues ...
-
bioRxiv - Plant Biology 2024Quote: ... the last 1969 bp of SUF4’s disordered region was synthesized (GenScript, USA) with base pair substitutions that replaced 12 of the 14 phenylalanine and lysine residues with serines ...
-
bioRxiv - Neuroscience 2024Quote: ... followed by denaturation at 95°C for 10 min and loading on 4-20% ExpressPlusTM PAGE gels (GenScript). The gel was allowed to run at 120V for 2 hours ...
-
bioRxiv - Microbiology 2024Quote: ... Ni+ based protein purification methods were followed by the protocol from Genscript.
-
bioRxiv - Microbiology 2024Quote: ... and PvRBP2b (cloned in a pEX vector) were synthesized by GenScript Biotech ...
-
bioRxiv - Microbiology 2024Quote: ... tissues were labeled with anti-NP-1 antibody (GenScript U864YFA140-4/CB2093 NP-1). Briefly ...
-
bioRxiv - Microbiology 2024Quote: ... codon optimized hf-yfp as well as linker sequences were ordered from GenScript. Genes for FPs and linkers were fused using overlap PCR ...
-
bioRxiv - Neuroscience 2024Quote: ... or they were synthesized by GenScript (Piscataway, NJ, USA). All plasmids were verified by sequencing by GenScript or Plasmidsaurus ...
-
bioRxiv - Neuroscience 2024Quote: ... All plasmids were verified by sequencing by GenScript or Plasmidsaurus ...
-
bioRxiv - Plant Biology 2024Quote: pFRI::FRI-mScarletI was custom-synthesized by GenScript and consists of the following elements ...
-
bioRxiv - Biochemistry 2024Quote: ... Eluates were pooled and mixed with 0.5 mL of anti-FLAG G1 affinity resin (GenScript) and incubated overnight in 15-mL conical tubes ...
-
bioRxiv - Biochemistry 2024Quote: The gene was synthesized and subcloned by GenScript Biotech (The Netherlands ...
-
bioRxiv - Neuroscience 2024Quote: ... Equal amounts of 10 μg protein lysate were loaded and separated on a 4-12% SurePAGETM gel (GenScript) and transferred to a polyvinylidene difluoride membrane (Millipore) ...
-
bioRxiv - Immunology 2024Quote: ... The B11 VH and VL coding regions were synthesized as gBlock™ dsDNA fragments (GenScript, Piscataway, NJ) and cloned in-frame into pcDNA3.1-based human IgG1 Fc and kappa light chain expression plasmids ...
-
bioRxiv - Immunology 2024Quote: ... primary Ab goat anti-human IgG-HRP (GenScript Inc), and goat anti-human Kappa-HRP (SouthernBiotech ...
-
bioRxiv - Molecular Biology 2024Quote: ... synthetized and cloned into a pET21(a) vector (between NdeI and XhoI restriction sites) by GenScript (Rijswijk, Netherlands). For all other proteins used in this work ...
-
bioRxiv - Molecular Biology 2024Quote: ... PolθH was collected and subject to endotoxin removal with a ToxinEraser Endotoxin Removal kit (GenScript). PolθH was concentrated ...
-
bioRxiv - Neuroscience 2024Quote: ... Proteins were separated by SDS-PAGE using 4%-20% MOPS-acrylamide gels (GenScript Express Plus M42012) and transferred electrophoretically onto Immobilon PVDF membrane (Merck) ...