Labshake search
Citations for GenScript :
551 - 600 of 1068 citations for Human Follicle Stimulating Hormone FSH Peptide since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2024Quote: ... coli codon-optimized 10xHis- PPEP-4 (lacking the signal peptide) construct was ordered from GenScript. The pET-16b 10xHis-PPEP-4 plasmid was transformed to E ...
-
bioRxiv - Bioengineering 2023Quote: ... The crosslinker solution was prepared by dissolving the MMP-cleavable peptide (Ac-GCRDGPQGIWGQDRCG-NH2, GenScript) in distilled water at 12 mm and 10 μm Alexa-Fluor 647-maleimide (Invitrogen) ...
-
bioRxiv - Bioengineering 2023Quote: ... dLN cells were restimulated in vitro in the presence of either OVA257-264 peptide (Genscript) at a final concentration of 1 mg/mL ...
-
bioRxiv - Microbiology 2023Quote: ... the coding sequences (CDS) of target SP and CT peptides were commercially synthesised (IDT, GenScript) as fragments codon-optimised for expression in E ...
-
bioRxiv - Neuroscience 2023Quote: ... 2011) or fluorescein Piccolo-peptides (fluor-IEDEEKPVDLTAGRRA) were synthesized and purified (>90% purity) by GenScript. Peptides were solubilized and frozen as a stock solution of 20 mM in water and diluted to a final concentration of 10 µM.
-
bioRxiv - Biochemistry 2023Quote: ... Synthetic peptides corresponding to Npm2 A2 and glutamylated counterparts were obtained from GenScript (Piscataway, NJ). The Npm2 119-146aa peptide was purified as previously described 9 ...
-
bioRxiv - Molecular Biology 2023Quote: The synthetic peptides containing the 8-residue long LC8 binding motifs were ordered from Genscript Ltd ...
-
bioRxiv - Bioengineering 2023Quote: ... buffer at pH 9 was functionalized with a thiolated cell-adhesive RGD peptide (GenScript, GCGYGRGDSPG) via a Michael-type addition reaction ...
-
bioRxiv - Zoology 2023Quote: ... The AedaeACP (pQVTFSRDWNAa) and AedaeAKH (pQLTFTPSWa) peptides were commercially synthesized (purity >90%; Genscript, Piscataway, NJ) and diluted in BSA assay media (0.1% BSA in DMEM ...
-
bioRxiv - Synthetic Biology 2024Quote: ... 0.5 µM of fluorescently labeled acceptor peptide TAMRA-GSDQNATF-NH₂ or TAMRA-GQYNSTAF-NH₂ (GenScript) and 32 µL of ddH2O ...
-
bioRxiv - Immunology 2024Quote: ... Fine epitope mapping was performed by ordering synthetic peptides with N-terminal biotin residues (Genscript: 17-mer YHHHHHHDYDIPTTENL ...
-
bioRxiv - Immunology 2024Quote: ... the wild-type (EEFNLPTTNGGHAT) and T548S (EEFNLPTSNGGHAT) forms of the peptides were commercially synthesized (GenScript) and purified (>98% purity ...
-
bioRxiv - Cancer Biology 2024Quote: ... Peptides with N terminal acetylation and C terminal amidation were purchased from Genscript (Rijswijk, Netherlands). Peptides were dissolved in DMSO ...
-
bioRxiv - Developmental Biology 2022Quote: ... residues A27-T157), human FZD7 CRD (UniProt: O75084, residues Q33-G170), human FZD8 CRD (UniProt: Q9H461, residues A28-T158) were synthesized (Genscript). Human LRP6 P1E1P2E2 (UniProt ...
-
bioRxiv - Plant Biology 2021Quote: ... Anti-human IgG peroxidase conjugated (A00166, GenScript, USA) or anti-mouse IgG peroxidase conjugated (A4416 ...
-
bioRxiv - Cancer Biology 2022Quote: ... murine and human CD20 cDNA expression constructs (GenScript) were transiently transfected into 293T cells using lipofectamine (ThermoFisher) ...
-
bioRxiv - Biophysics 2022Quote: The gene that encodes human SERINC3 (Genscript-OHu02717D) was inserted upstream of a thrombin protease cleavable linker (LVPRGS ...
-
bioRxiv - Cell Biology 2023Quote: ... human NAP1 cDNA was gene-synthesized (by Genscript) and subcloned into a pGEX-4T1 vector with an N-terminal MBP-tag followed by a TEV cleavage site before wild-type NAP1 (RRID:Addgene_208871) ...
-
bioRxiv - Cancer Biology 2022Quote: The H3F3A and H3F3B human cDNA sequences (GenScript) were cloned by using ClaI and EcoRI restriction enzymes into the pSNAPm plasmid (New England Biolabs) ...
-
bioRxiv - Biophysics 2022Quote: The human PEAK3 gene was synthesized by GenScript and subcloned into the pcDNA4/TO vector with a C-terminal 3xFLAG tag ...
-
bioRxiv - Molecular Biology 2022Quote: ... Human SENP1 cDNA (ENST00000448372.5) was synthesised by GenScript to contain an N terminal FLAG tag and synonymous siRNA resistance mutations to the exon 6 and 12 siRNA used (see table 1) ...
-
bioRxiv - Neuroscience 2024Quote: ... Purified human GST-PABPN1 was obtained from GenScript.
-
bioRxiv - Biochemistry 2024Quote: ... The human S100A9 gene was purchased from Genscript (Clone ID ...
-
bioRxiv - Biophysics 2024Quote: ... and human LRRC8a (hLRRC8a: 56262) were synthesized (GenScript) and subcloned using a standard molecular cloning techniques into pIE2 vector for transient expression in HEK cells ...
-
bioRxiv - Plant Biology 2021Quote: ... This polyclonal antibody was raised in rabbits against a synthetic peptide (CKTYLGRPWKEYSRT) (Genscript, Piscataway, NJ, USA) that includes the highly conserved amino acid sequence including residue in the catalytic site of PMEs (Markovič and Janeček ...
-
bioRxiv - Neuroscience 2020Quote: NR peptide was synthesized with a N-terminal 5-FAM modification by GenScript (Piscataway, NJ, USA). Hsp70 was titrated in triplicate while the NR-peptide concentration remained constant at 20nM ...
-
bioRxiv - Cell Biology 2021Quote: KLC1D/E synthetic peptides used for CD or NMR measurements were purchased from Genscript (>98% purity). Sequences were as follows ...
-
bioRxiv - Cell Biology 2021Quote: WIPI2d10-364Δ263-295: ATG16L1 (207-230) complex was formed overnight with 5X molar excess peptide (GenScript). Crystals of the complex were grown using hanging drop vapor diffusion method at 4°C ...
-
bioRxiv - Cell Biology 2022Quote: ... P-factor (TYADFLRAYQSWNTFVNPDRPNL) and α-factor (WHWLQLKPGQPMY) (Custom Peptide Synthesis, 4 mg, ≥95% purity, GenScript Biotech) were dissolved in DMSO to a concentration of 10 mM ...
-
bioRxiv - Neuroscience 2020Quote: ... Rabbit anti-CCHa1 (Our lab raised antibodies against the peptide QIDADNENYSGYELT 68, Genscript, 1:50 dilution). Secondary antibodies used ...
-
bioRxiv - Biophysics 2021Quote: ... These peptide films were then dissolved according to their hydrophobic character and solvent recommended by GenScript and Thermo Scientific ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Each 7-mer D-peptide with an N-terminal cysteine was synthesized by GenScript (Piscataway, NJ). Peptides were conjugated with IRDye 800CW maleimide (Li-Cor ...
-
bioRxiv - Biochemistry 2021Quote: ... coli PcoB including its signal peptide (UniProt Accession No.Q47453) was codon optimized and synthesized by Genscript. A 6xHis tag followed by a TEV cleavage site was introduced between S26 and V27 by overlap PCR to facilitate protein purification ...
-
bioRxiv - Immunology 2021Quote: ... A peptide representing the mouse ANGPTL4 amino acids 29-53 (29QPEPPRFASWDEMNLLAHGLLQLGH53) was also synthesized by Genscript) with the same C-terminal-GGGC modification ...
-
bioRxiv - Biochemistry 2023Quote: N-terminally biotinylated synthetic MUC1 peptide with the sequence biotin-GGS-APDTRPAPG was ordered from Genscript. This was dissolved in PBS and printed on a planar streptavidin-coated SPR chip (P-Strep ...
-
bioRxiv - Biophysics 2023Quote: The ORF6-CTR peptide with sequence 38-KNLSKSLTENKYSQLDEEQPMEID-61 was commercially synthesized and obtained from Genscript LLC ...
-
bioRxiv - Plant Biology 2023Quote: ... SCOOP10 and SCOOP12 peptides were labeled with fluorescent 5-FAM at the N-termini (GenScript, China) and the final working concentration of labelled peptides was adjusted to 0.05 μM with ddH2O ...
-
bioRxiv - Immunology 2022Quote: RMA-S/HLA-E cells were incubated with serial dilutions of peptides (3-300 μM, Genscript) in OptiMEM (ThermoFisher ...
-
bioRxiv - Biochemistry 2024Quote: Acetylated and fluorescein (FITC)-labeled tau peptides for crystallography and fluorescence anisotropy were purchased from GenScript (sequence ...
-
bioRxiv - Biochemistry 2023Quote: ... The synthesis of the surrogate peptides both labeled and unlabeled was done by GenScript (Piscataway, NJ) and provided in lyophilized form.
-
bioRxiv - Biochemistry 2023Quote: A 27 amino acid peptide containing amino acids 340-366 of RAD18 was purchased from GenScript and used at 200 µM for ITC binding experiments ...
-
bioRxiv - Microbiology 2023Quote: ... a custom-synthetized N-terminally biotinylated peptide comprising residues Met1 to Gln38 of LmdC (GenScript, USA) was immobilized on the biosensors ...
-
bioRxiv - Biophysics 2022Quote: ... The target protein complexes were eluted twice with 500 μg/ml 3× DYKDDDDK peptide (RP21087, GenScript) dissolved in the wash buffer ...
-
bioRxiv - Biochemistry 2022Quote: ... Fluorescein amide-labeled SSB C-terminal peptide (5-FAM WMDPDDDIPF) was synthesized and purified commercially (GenScript).
-
bioRxiv - Pathology 2024Quote: ... MoSpa2-WH2 like peptide (NKARDKLQRLTTVQFLELSTDVYDELNRRF) and ScSpa2-control motif (MGTSSEVSLAHHRDIFHYYVSLKTFFEVT) were first synthesized by GenScript (China). Peptide powder was dissolved in reaction buffer (20 mM Hepes ...
-
bioRxiv - Molecular Biology 2024Quote: Absolute quantification of CKP was performed using external calibration with a commercially synthesized peptide (GenScript, USA) of GST at its core region (amino acid 104-108 ...
-
bioRxiv - Immunology 2024Quote: ... Cells were stimulated with an overlapping peptide pool derived from SARS-CoV-2 Spike protein (Genscript). Following 2 hours of culture ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Solid-phase peptide synthesis (SPPS) and purified macrocycle standards were generated by a commercial manufacturer (GenScript).
-
bioRxiv - Microbiology 2024Quote: ... Bound proteins were eluted off three times by incubation with 1x FLAG peptide (450ng/uL; Genscript) in 50 μL Wash buffer 2 ...
-
bioRxiv - Molecular Biology 2024Quote: ... IgG clones cross-reacting with the SF3A2 peptide were obtained by single B-cell sequencing (GenScript). These were coupled to Protein G-agarose (Pierce) ...