Labshake search
Citations for GenScript :
501 - 550 of 754 citations for POTEG Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2024Quote: PEG hydrogels were functionalized with the following peptides and proteins purchased from Genscript (Piscataway, NJ): RGDS ...
-
bioRxiv - Cell Biology 2024Quote: ... aureus auto inducer peptide (AIP) of 98% purity was purchased from GenScript (Piscataway, NJ, USA). Keratinocyte growth medium-2 (KGM-2 ...
-
bioRxiv - Immunology 2022Quote: ... Both crude (∼50% purity) and purified (>95% purity; TFA removed) peptides were synthesized by GenScript USA ...
-
bioRxiv - Bioengineering 2023Quote: ... buffer at pH 9 was functionalized with a thiolated cell-adhesive RGD peptide (GenScript, GCGYGRGDSPG) via a Michael-type addition reaction ...
-
bioRxiv - Zoology 2023Quote: ... The AedaeACP (pQVTFSRDWNAa) and AedaeAKH (pQLTFTPSWa) peptides were commercially synthesized (purity >90%; Genscript, Piscataway, NJ) and diluted in BSA assay media (0.1% BSA in DMEM ...
-
bioRxiv - Molecular Biology 2023Quote: The synthetic peptides containing the 8-residue long LC8 binding motifs were ordered from Genscript Ltd ...
-
bioRxiv - Bioengineering 2023Quote: ... The crosslinker solution was prepared by dissolving the MMP-cleavable peptide (Ac-GCRDGPQGIWGQDRCG-NH2, GenScript) in distilled water at 12 mm and 10 μm Alexa-Fluor 647-maleimide (Invitrogen) ...
-
bioRxiv - Neuroscience 2023Quote: ... 2011) or fluorescein Piccolo-peptides (fluor-IEDEEKPVDLTAGRRA) were synthesized and purified (>90% purity) by GenScript. Peptides were solubilized and frozen as a stock solution of 20 mM in water and diluted to a final concentration of 10 µM.
-
bioRxiv - Bioengineering 2023Quote: ... dLN cells were restimulated in vitro in the presence of either OVA257-264 peptide (Genscript) at a final concentration of 1 mg/mL ...
-
bioRxiv - Microbiology 2023Quote: ... the coding sequences (CDS) of target SP and CT peptides were commercially synthesised (IDT, GenScript) as fragments codon-optimised for expression in E ...
-
bioRxiv - Biochemistry 2023Quote: ... Synthetic peptides corresponding to Npm2 A2 and glutamylated counterparts were obtained from GenScript (Piscataway, NJ). The Npm2 119-146aa peptide was purified as previously described 9 ...
-
bioRxiv - Biochemistry 2024Quote: ... and competence was induced by adding 500 ng/mL competence-stimulating peptide (CSP-1; GenScript). After 15 min incubation ...
-
bioRxiv - Plant Biology 2021Quote: ... This polyclonal antibody was raised in rabbits against a synthetic peptide (CKTYLGRPWKEYSRT) (Genscript, Piscataway, NJ, USA) that includes the highly conserved amino acid sequence including residue in the catalytic site of PMEs (Markovič and Janeček ...
-
bioRxiv - Neuroscience 2020Quote: NR peptide was synthesized with a N-terminal 5-FAM modification by GenScript (Piscataway, NJ, USA). Hsp70 was titrated in triplicate while the NR-peptide concentration remained constant at 20nM ...
-
bioRxiv - Cell Biology 2021Quote: KLC1D/E synthetic peptides used for CD or NMR measurements were purchased from Genscript (>98% purity). Sequences were as follows ...
-
bioRxiv - Cell Biology 2021Quote: WIPI2d10-364Δ263-295: ATG16L1 (207-230) complex was formed overnight with 5X molar excess peptide (GenScript). Crystals of the complex were grown using hanging drop vapor diffusion method at 4°C ...
-
bioRxiv - Cell Biology 2022Quote: ... P-factor (TYADFLRAYQSWNTFVNPDRPNL) and α-factor (WHWLQLKPGQPMY) (Custom Peptide Synthesis, 4 mg, ≥95% purity, GenScript Biotech) were dissolved in DMSO to a concentration of 10 mM ...
-
bioRxiv - Neuroscience 2020Quote: ... Rabbit anti-CCHa1 (Our lab raised antibodies against the peptide QIDADNENYSGYELT 68, Genscript, 1:50 dilution). Secondary antibodies used ...
-
bioRxiv - Biophysics 2021Quote: ... These peptide films were then dissolved according to their hydrophobic character and solvent recommended by GenScript and Thermo Scientific ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Each 7-mer D-peptide with an N-terminal cysteine was synthesized by GenScript (Piscataway, NJ). Peptides were conjugated with IRDye 800CW maleimide (Li-Cor ...
-
bioRxiv - Immunology 2021Quote: ... human recombinant IL-2 (10 U/well) and with or without NP311 or NP366 peptides (Genscript) at 0.2ug/ml ...
-
bioRxiv - Biophysics 2019Quote: A synthetic peptide from CPSF6 comprising residues 313-327 with a C-terminal cysteine (PVLFPGQPFGQPPLGC, Genscript) was dissolved (1.85 mM ...
-
bioRxiv - Biochemistry 2021Quote: ... coli PcoB including its signal peptide (UniProt Accession No.Q47453) was codon optimized and synthesized by Genscript. A 6xHis tag followed by a TEV cleavage site was introduced between S26 and V27 by overlap PCR to facilitate protein purification ...
-
bioRxiv - Immunology 2021Quote: ... A peptide representing the mouse ANGPTL4 amino acids 29-53 (29QPEPPRFASWDEMNLLAHGLLQLGH53) was also synthesized by Genscript) with the same C-terminal-GGGC modification ...
-
bioRxiv - Biophysics 2022Quote: ... The target protein complexes were eluted twice with 500 μg/ml 3× DYKDDDDK peptide (RP21087, GenScript) dissolved in the wash buffer ...
-
bioRxiv - Immunology 2022Quote: RMA-S/HLA-E cells were incubated with serial dilutions of peptides (3-300 μM, Genscript) in OptiMEM (ThermoFisher ...
-
bioRxiv - Biochemistry 2024Quote: Acetylated and fluorescein (FITC)-labeled tau peptides for crystallography and fluorescence anisotropy were purchased from GenScript (sequence ...
-
bioRxiv - Biochemistry 2023Quote: ... The synthesis of the surrogate peptides both labeled and unlabeled was done by GenScript (Piscataway, NJ) and provided in lyophilized form.
-
bioRxiv - Biochemistry 2023Quote: A 27 amino acid peptide containing amino acids 340-366 of RAD18 was purchased from GenScript and used at 200 µM for ITC binding experiments ...
-
bioRxiv - Biochemistry 2023Quote: N-terminally biotinylated synthetic MUC1 peptide with the sequence biotin-GGS-APDTRPAPG was ordered from Genscript. This was dissolved in PBS and printed on a planar streptavidin-coated SPR chip (P-Strep ...
-
bioRxiv - Biophysics 2023Quote: The ORF6-CTR peptide with sequence 38-KNLSKSLTENKYSQLDEEQPMEID-61 was commercially synthesized and obtained from Genscript LLC ...
-
bioRxiv - Biochemistry 2022Quote: ... Fluorescein amide-labeled SSB C-terminal peptide (5-FAM WMDPDDDIPF) was synthesized and purified commercially (GenScript).
-
bioRxiv - Plant Biology 2023Quote: ... SCOOP10 and SCOOP12 peptides were labeled with fluorescent 5-FAM at the N-termini (GenScript, China) and the final working concentration of labelled peptides was adjusted to 0.05 μM with ddH2O ...
-
bioRxiv - Microbiology 2023Quote: ... a custom-synthetized N-terminally biotinylated peptide comprising residues Met1 to Gln38 of LmdC (GenScript, USA) was immobilized on the biosensors ...
-
bioRxiv - Microbiology 2024Quote: ... Bound proteins were eluted off three times by incubation with 1x FLAG peptide (450ng/uL; Genscript) in 50 μL Wash buffer 2 ...
-
bioRxiv - Pathology 2024Quote: ... MoSpa2-WH2 like peptide (NKARDKLQRLTTVQFLELSTDVYDELNRRF) and ScSpa2-control motif (MGTSSEVSLAHHRDIFHYYVSLKTFFEVT) were first synthesized by GenScript (China). Peptide powder was dissolved in reaction buffer (20 mM Hepes ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Solid-phase peptide synthesis (SPPS) and purified macrocycle standards were generated by a commercial manufacturer (GenScript).
-
bioRxiv - Biophysics 2022Quote: ... Protein was eluted by incubation with 3 BVs elution buffer (wash buffer supplemented with either 3C protease (1:10 w:w 3C:ABCA7) or 0.5 mg ml-1 1D4 peptide (GenScript)) for 2-18 hours.
-
bioRxiv - Molecular Biology 2020Quote: Specific treatment conditions were as follows: GPCR activation – Cells were treated with α-factor peptide hormone (Genscript) at 3μM final concentration ...
-
bioRxiv - Biophysics 2019Quote: ... TRPV2 was eluted with Wash Buffer containing 0.006% DMNG and 3 mg/ml 1D4 peptide (GenScript USA) and subjected to size-exclusion chromatography using a Superose 6 column (GE Healthcare ...
-
bioRxiv - Biochemistry 2021Quote: All peptides (see all sequences in Supplementary Tables 1) were purchased at 95% purity (Genscript, Leiden, Netherlands). NAD was purchased from Roche (Basel ...
-
bioRxiv - Biochemistry 2021Quote: Purified PX domain was specifically labeled on its N-terminal glycine with a FITC-LPETGG peptide (Genscript) in a Sortase-mediated reaction according to the protocol described in (Theile et al ...
-
bioRxiv - Biochemistry 2022Quote: ... A peptide corresponding to the human CRX homeodomain (amino acids 39 to 98) was synthesized by Genscript.
-
bioRxiv - Biochemistry 2022Quote: The 10 C-terminal residues of Caulobacter crescentus RNase E (EKPRRGWWRR) (GWW peptide) were synthesized by GenScript with C-terminal amidation and dissolved in Milli-Q water ...
-
bioRxiv - Neuroscience 2021Quote: ... these cells were cultured in the presence of the OVA257-264 peptide (GenScript RP10611 or Sigma S7951). After 12 hours ...
-
bioRxiv - Immunology 2020Quote: Synthetic peptides were generated by Fmoc (9-fluorenylmethoxy carbonyl) chemistry to a purity of 85% by Genscript USA ...
-
bioRxiv - Biochemistry 2021Quote: The tetramethylrhodamine (TMR) labeled peptide with sequence Gly-Gly-GLy-Ser-{Lys-(TMR)}was purchased from Genscript. Its mass ...
-
bioRxiv - Biochemistry 2021Quote: ... MHC tetramers29 were synthesized by the NIH Tetramer Core Facility (Atlanta, GA) using custom peptides from GenScript. The peptide sequences are SIINFEKL (OVA) ...
-
bioRxiv - Immunology 2021Quote: ... Synthetic cDNAs encoding the heavy chains and light chains of H5.31 and H5.28 Fabs were synthesized and cloned into pcDNA3.1 (+) downstream of the CD5 signal peptide (Genscript). Expi293F cells were transfected transiently with pcDNA3.1 (+ ...
-
bioRxiv - Immunology 2021Quote: ... All other peptides were 13 amino acids overlapping by 11 amino acids and were synthesized by GenScript. The peptides covering the envelope (E) ...