Labshake search
Citations for Takara Bio :
1 - 50 of 447 citations for pEGFP C2 since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2020Quote: ... pEGFP-C2 (Clontech) was used to generate BLOS1-GFP-C2 and RAB11A-GFP plasmids ...
-
bioRxiv - Cell Biology 2021Quote: ... pEGFP-C2 (Clontech) was used as an empty vector control ...
-
bioRxiv - Cell Biology 2023Quote: ... pEGFP-C2 vector (Clontech), pCMV-Tag5 vector (Stratagene ...
-
bioRxiv - Microbiology 2023Quote: ... pEGFP-c2 from Clontech. GFP-LANA and LANA deletion plasmids were described previously 40,68 ...
-
bioRxiv - Molecular Biology 2020Quote: ... EGFP in pEGFP-C2 (Takara Bio) was replaced by the wild-type CARD14 gene obtained from pFN21AE3344 with N-terminal 3xFLAG tag peptides (DYKDHDGDYKDHDIDYKDDDDK ...
-
bioRxiv - Cell Biology 2021Quote: ... Ezrin constructs in pEGFP-C2 (Clontech): hEzrin wildtype (EGFP-Ezrin/WT ...
-
bioRxiv - Cell Biology 2021Quote: ... pEGFP-c2 (Takara Bio Inc., Japan), or pMal-c5x (New England Biolabs) ...
-
bioRxiv - Cell Biology 2021Quote: ... pEGFP-c2 (Takara Bio Inc., Japan), or pMal-c5x (New England Biolabs) ...
-
bioRxiv - Molecular Biology 2023Quote: The commercially available pEGFP-C2 (Clontech) plasmid was used as a sense EGFP construct ...
-
bioRxiv - Cell Biology 2020Quote: pEGFP-C2 vector was purchased from Clontech Inc ...
-
bioRxiv - Cell Biology 2020Quote: ... and cloned into pEGFP-C2 vector (Clontech).
-
bioRxiv - Cell Biology 2020Quote: ... by PCR and inserted to vectors peGFP-C2 and pmRFP1-C2 (originally Clontech), designed for expression of protein chimeras with a fluorescent protein connected to the N-terminus of the target protein ...
-
bioRxiv - Biochemistry 2020Quote: ... Five micrograms of reporter plasmid pEGFP-C2 (Clontech), coding the green fluorescent protein ...
-
bioRxiv - Cell Biology 2020Quote: ... EGFP was PCR-amplified from pEGFP-C2 (Clontech) and similarly cloned into the pRSET His-SS-TEV vector ...
-
bioRxiv - Genetics 2020Quote: ... created by modification of the pEGFP-C2 vector (Clontech) as described before51 ...
-
bioRxiv - Cancer Biology 2021Quote: The eGFP coding sequence from the pEGFP-C2 vector (Clontech), with or without the coding sequence of wild-type human TRPV2 (12 ...
-
bioRxiv - Cell Biology 2023Quote: ... as a template and inserted into pEGFP-C2 vector (Takara Bio) digested with EcoRI using the In-Fusion HD Cloning Kit ...
-
bioRxiv - Neuroscience 2023Quote: pEGFP-USP48 was generated by sub-cloning the mouse USP48 into the mammalian expression vector pEGFP-C2 (Clontech). pCMV-Myc-USP48 ...
-
bioRxiv - Biophysics 2021Quote: ... GRB2-HaloTag was constructed using the human GRB2-encoding fragment and inserted into the Halo7-C2 vector in which the monomeric EGFP sequence in the pEGFP-C2 vector (Clontech) was substituted to the Halo7 sequence from the FN19K HaloTag T7 SP6 Flexi Vector (Promega).
-
bioRxiv - Neuroscience 2020Quote: Mouse Nwd1 cDNAs were subcloned into the pEGFP-C2 vector (Clontech Takara Bio) to express the Nwd1 protein fused with EGFP ...
-
bioRxiv - Microbiology 2021Quote: ... for expression with a C-terminal GFP tag or into pEGFP-C2 (Clontech) for expression with an N-terminal GFP tag and a codon-optimised synthetic gene (GeneArt ...
-
bioRxiv - Neuroscience 2020Quote: Mouse Nwd1 cDNAs were subcloned into the pEGFP-C2 vector (Clontech Takara Bio) to express the Nwd1 protein fused with EGFP ...
-
bioRxiv - Microbiology 2023Quote: ... and cloning it into the EcoRI and SalI sites of pEGFP-C2 (Clontech). pRetroX-TRE3G-hAPOBEC1-3xflag and pRetroX-TRE3G- mAPOBEC1-3xflag were constructed by cloning the entire coding sequences of hAPOBEC1 and mAPOBEC1 amplified from pcDNA-hAPOBEC1 and pEGFP-mA1 ...
-
bioRxiv - Cancer Biology 2023Quote: ... and cloned into the SmaI-linearized pEGFP-C2 vector (Clontech, Catalog No. 632481). Luciferase activity was conducted using a plasmid encoding luciferase under the regulation of the rRNA promoter (provided by L.-L ...
-
bioRxiv - Microbiology 2024Quote: ... MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELSFLPSDFFPSVRDLLDTA SALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMG LKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPR RRTPSPRRRRSQSPRRRRSQSRESQC)[8] was cloned into the pEGFP-C2 vector (Clontech) using Gibson assembly[9] by replacing the gene sequence coding for eGFP ...
-
bioRxiv - Molecular Biology 2020Quote: ... 2.5 μg of PrimPol variant expressing pcDNA3.1/nV5-DEST vectors11 or control plasmid pEGFP-C2 (Clontech) were transfected for the last 24 h using TransIT-2020 (Mirus Bio) ...
-
bioRxiv - Molecular Biology 2023Quote: HEK293T/17 cells were co-transfected with 0.8 pmol SINEUP-GFP or miniSINEUP-GFP FRAM (0.8 pmol) and 0.2 pmol sense pEGFP-C2 plasmids (Clontech) in each well of a 6-well culture plate ...
-
bioRxiv - Cell Biology 2020Quote: EGFP-Rab5 construct was generated by PCR amplifying human Rab5a from cDNA and subcloning into the pEGFP-C2 (Clontech) vector using XhoI/BamHI restriction sites ...
-
bioRxiv - Cell Biology 2020Quote: ... 35 mm wells of MIN6 cells were co-transfected with 2.5 µg of pX330 containing gRNAs and 1 µg of pEGFP-C2 (Clontech). After 48 h ...
-
bioRxiv - Cell Biology 2024Quote: ... The GFP-Angptl3 construct was generated by cloning the cDNA of human ANGPTL3 into the pEGFP-C2 vector (Clontech) at EcoRI and ApaI sites ...
-
bioRxiv - Genetics 2020Quote: ... Full length wild type NHR-25 was tagged with EGFP at its N-terminus using pEGFP-C2 plasmid vector (Clontech); wild-type and mutant LIR-2s were N-terminally FLAG-tagged using the p3xFLAG-CMV-10 expression vector (SIGMA-Aldrich) ...
-
bioRxiv - Cell Biology 2020Quote: ... GFP CIZ1 C275 was made by ligating the 1 kb C-terminal XhoI fragment (Coverley et al., 2005) into the XhoI site of pEGFP-C2 (Clontech). GFP CIZ1 Δp8 (this study ...
-
bioRxiv - Cell Biology 2022Quote: ... were PCR amplified from the full-length cDNAs and cloned into the NheI and BamHI or into the HindIII and BamHI restriction sites of the pEGFP-C2 vectors (Clontech), resulting in untagged soluble proteins or proteins tagged with a GFP fused to its N-terminus ...
-
bioRxiv - Genetics 2020Quote: ... and complementary primer pairs (sequences available on request) was used to generate TMEM127 variants in the pEGFP-C2 (Clontech Laboratories) and pCMV6-XL5 (Origene ...
-
bioRxiv - Molecular Biology 2023Quote: Plasmid pCMV-GFP-Zfp106 was created by cloning the Zfp106 cDNA into the XhoI-EcoRI sites in pEGFP-C2 (Clontech). Plasmid pCMV-RFP-Zfp106 was created by replacing EGFP in plasmid pCMV-GFP-Zfp106 with NLS-TagRFP ...
-
bioRxiv - Molecular Biology 2024Quote: pHUE-eGFP-Clu-tail was generated by restriction and insertion cloning with a DNA fragment encoding eGFP-Clu-tail amplified from pEGFP-C2 (Clontech) by nested PCR using primers encoding Clu(228-238 ...
-
bioRxiv - Cell Biology 2021Quote: ... D4H was generated by site-directed mutagenesis using the primers 5’-TGTTTTAGATTGATAATTTCCATCCCATGTTTT-3’ and 5’-CGGACTCAGATCTCGAAGGGAAAAATAAACTTAGA-3’ and inserted into pEGFP-C2 vector (TaKaRa Bio) by the In-Fusion reaction ...
-
bioRxiv - Neuroscience 2022Quote: cDNA fragments corresponding to Inka1 and Inka2 ORFs were isolated using RT-PCR of the RNAs of E12 embryonic and adult mice brains and subcloned in-frame into a pEGFP-C2 expression vector (Takara Bio Inc., Shiga, Japan). To construct the CAG promoter-driven Inka2 in mammalian cells ...
-
bioRxiv - Cancer Biology 2022Quote: ... pEGFP (Clontech), are described elsewhere ...
-
bioRxiv - Molecular Biology 2020Quote: ... pEGFP (Clontech), for expression of COX8a/ATG4D-(SaCas9/LbCas12a/AsCas12a)-GFP or LbCas12a-GFP ...
-
bioRxiv - Cell Biology 2021Quote: ... pEGFP-N1 and pEGFP-C1 plasmids were purchased from Clontech Laboratories ...
-
bioRxiv - Cell Biology 2022Quote: ... The pEGFP-P2A-RFP expression vector (pEGFP-N1 Clontech backbone) was a kind gift from Prof ...
-
bioRxiv - Cell Biology 2020Quote: pEGFP-N1 (Clontech) was the backbone for many of the plasmids used in this study ...
-
bioRxiv - Cell Biology 2020Quote: ... pEGFP-N2 (Clontech) was used for KIF13A-GFP ...
-
bioRxiv - Biochemistry 2021Quote: ... pEGFP-C1 (Clontech) containing FLAG-XRCC4 (denoted GFP-XRCC4) ...
-
bioRxiv - Cancer Biology 2021Quote: pEGFP-C1 (Clontech) plasmid was digested with BamHI and BglII to generate a 51-bp fragment which was inserted into the BamHI site of pCSCMV:tdTomato to generate a SmaI restriction site immediately downstream from the BamHI site ...
-
bioRxiv - Neuroscience 2022Quote: ... pEGFP-N1 (Clontech), pCS-membrane-ceruleanFP (kind gift from Dr ...
-
bioRxiv - Cell Biology 2022Quote: ... pEGFP-actin (Clontech), Actin-Chromobody-TagGFP2 (AC-GFP ...
-
bioRxiv - Cell Biology 2022Quote: ... pEGFP-N1 (Clontech), pEGFP-actin (Clontech) ...
-
bioRxiv - Molecular Biology 2021Quote: ... pEGFP-C3 (Clontech), or p3xFLAG-Myc-CMV-24 (Sigma-Aldrich) ...