Labshake search
Citations for Takara Bio :
651 - 700 of 1523 citations for Recombinant Human FCGRT & B2M Protein His Avi Strep II tagged Biotinylated since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2020Quote: ... each well of the lysis plates contained 0.4 μL lysis buffer [0.5 U Recombinant RNase Inhibitor (Takara Bio, 2313B), 0.0625% Triton X-100 (Sigma ...
-
bioRxiv - Microbiology 2022Quote: The recombinant pGBKT7-TaPHB-1 was transformed into Y2HGold yeast strain following the Yeastmaker Yeast Transformation System 2 (TaKaRa). The transformants were screened on SD/-Trp agar plate ...
-
bioRxiv - Cancer Biology 2022Quote: ... the recombinant pAAV-CRE plasmid was packaged in HEK293T cells using pHelper and pRC2-mi342 plasmids (Takara, Catalog #632608). Cells were harvested three days after transfection and AAV2 was isolated using AAVpro Extraction Solution (Takara ...
-
bioRxiv - Immunology 2022Quote: ... Recombinant adenovirus vaccines were produced using the Adeno-X™ Adenoviral System 3 according to the manufacturer’s manual (Takara Korea Biomedical Inc. ...
-
bioRxiv - Microbiology 2022Quote: ... The recombinant adenovirus was prepared in HEK293 cells and purified with an Adeno-X Virus Purification kit (Takara Bio). The purified virus titer was determined using an Adeno-X Rapid Titer kit (Takara Bio) ...
-
bioRxiv - Genomics 2023Quote: ... The recombinant pAAV-CRE plasmid was packaged in HEK293T cells using pHelper and pRC2-mi342 plasmids (Takara, Catalog #632608). Cells were harvested three days after transfection and AAV2 was isolated using AAVpro Extraction Solution (Takara ...
-
bioRxiv - Neuroscience 2024Quote: ... After the addition of 5 µl lysis buffer (0.2% Triton X-100, with 2 U/μl recombinant RNase inhibitor, Clontech) to the cap ...
-
bioRxiv - Biochemistry 2019Quote: ... Protein purity and concentration were determined by SDS-PAGE and BCA protein assay kit (Takara) respectively ...
-
bioRxiv - Biophysics 2019Quote: ... cDNAs encoding cyan fluorescent protein (CFP) and yellow fluorescent protein (YFP) were purchased from Clontech Com ...
-
bioRxiv - Cell Biology 2022Quote: ... Total protein was quantified using the TAKARA BCA Protein Assay Kit (TAKARA Bio Inc., Japan). Equal amounts of protein were separated by SDS-PAGE on 10% gels ...
-
Actin binding domain of Rng2 sparsely bound on F-actin strongly inhibits actin movement on myosin IIbioRxiv - Biophysics 2022Quote: ... which had a TEV protease recognition sequence between the 6×His sequence and the multiple cloning site of pColdI (Takara Bio, Kusatsu, Japan). The amino acid sequence of His-TEV Rng2CHD was MNHKVHHHHHHIEGRHMENLYFQGTLEGSEFKLDVNVGL…(Rng2CHD)…LPNFKA ...
-
bioRxiv - Synthetic Biology 2020Quote: Yeast with the uracil auxotrophy were cultivated in complete synthetic media without uracil prepared with -His-Ura dropout supplement (Clontech, Mountain View, CA) according to manufacturer’s instructions and supplemented with 20 g/mL histidine and 80mg/L adenine hemisulfate (Sigma-Aldrich ...
-
bioRxiv - Biophysics 2019Quote: ... cells bearing the corresponding plasmids and were purified according to.63 Partially purified lysates were loaded onto equilibrated cobalt His-TALON columns (Clontech, Mountain View, CA). The column was washed with 40 to 50 volumes of wash buffer (50 mM NaH2PO4 ...
-
bioRxiv - Neuroscience 2023Quote: ... LRP10 sequence-verified cDNA was subcloned from the pcDNA™3.1-LRP10-V5-His-TOPO® plasmid described previously (9) into the pLVX-EF1α-IRES-mCherry plasmid (Takara Bio, 631987). Briefly ...
-
bioRxiv - Neuroscience 2023Quote: ... LRP10 sequence-verified cDNA was subcloned from the pcDNA™3.1-LRP10-V5-His-TOPO® plasmid (Quadri et al., 2018) into the pLVX-EF1α-IRES-mCherry plasmid (Takara Bio, 631987) via Gibson Assembly® (NEB ...
-
bioRxiv - Plant Biology 2020Quote: ... using a TB Green Premix EX Taq II (Tli RNaseH Plus) Kit (Takara). The calculation method for relative gene expression levels were performed as described previously (Li et al. ...
-
bioRxiv - Cell Biology 2020Quote: ... and qPCR was performed using SYBR Premix Ex Taq II (RR820L, TaKaRa, Japan) in an ABI 7500 Real-Time PCR System (Applied Biosystems ...
-
bioRxiv - Immunology 2021Quote: ... Real-time PCR was performed using SYBR Premix Ex Taq II (Takara Bio). The primers used in the assay were as follows ...
-
bioRxiv - Genetics 2021Quote: ... Reverse transcription was performed using PrimeScript II 1st strand cDNA Synthesis Kit (TAKARA) following the manufacture’s protocol ...
-
bioRxiv - Plant Biology 2022Quote: ... RT-PCR was conducted using TB Green Premix Ex Taq II (Takara Bio) in a CFX96 Real Time PCR Detection System (Bio-Rad ...
-
bioRxiv - Microbiology 2019Quote: ... 1 × GC buffer II and 1 U of LA Taq DNA polymerase (TaKaRa). The PCR cycles consisted of 95 °C for 5 min ...
-
bioRxiv - Plant Biology 2019Quote: ... using TB Green Premix Ex Taq II (Tli RNase H Plus) (Takara, #RR820B).
-
bioRxiv - Cancer Biology 2019Quote: ... cDNA was synthesized using the PrimeScriptR II 1st strand cDNA Synthesis Kit (Takara) by random primer and oligo dT primer mixture ...
-
bioRxiv - Microbiology 2019Quote: ... and SYBR® Premix Ex Taq™ II (Tli RNase H Plus) (Takara) according to the manufacturer’s protocol ...
-
bioRxiv - Genetics 2019Quote: ... TB Green Premix Ex Taq II (Tli RNaseH Plus, Takara, Code No. RR820A) was used on BIO-CFX96 Touch.
-
Screening and identification of MicroRNAs expressed in perirenal adipose tissue during rabbit growthbioRxiv - Developmental Biology 2019Quote: ... Q-PCR was performed using Green II qRT-PCR kits (Takara, Dalian, China) according to the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2021Quote: ... PCR was performed using the TB Green Ex Taq II Mix (Takara Bio) and the Thermal Cycler Dice Real Time System (Takara Bio ...
-
bioRxiv - Microbiology 2020Quote: ... qRT-PCR was performed with SYBR Premix Ex Taq II (Takara, Dalian, China) using Mx3000P (Stratagene ...
-
bioRxiv - Plant Biology 2021Quote: ... with SYBR Premix Ex Taq II (Tli RNaseH Plus) ROX plus (Takara Bio), with primers previously described in (Yang et al. ...
-
bioRxiv - Plant Biology 2021Quote: ... and reverse transcribed using the PrimeScript II 1st Strand cDNA Synthesis Kit (TaKaRa). qPCR was carried out using the SYBR Green master mix on a QuantStudio 3 Real-Time PCR System (Applied Biosystems ...
-
bioRxiv - Cancer Biology 2020Quote: ... and cDNA products were amplified using SYBR ® Premix ExTaqTM II Kit (TaKaRa), GAPDH was served as an internal control for total cDNA content ...
-
bioRxiv - Cell Biology 2021Quote: ... cDNA was generated with PrimeScript™ II 1st strand cDNA Synthesis Kit (Takara). Semi-quantitative PCR was performed with EmeraldAmp MAX PCR Master Mix (Takara) ...
-
bioRxiv - Plant Biology 2022Quote: ... qRT-PCR was carried out with SYBR Premix Ex Taq II Premix (Takara) on the real-time system (Roche ...
-
bioRxiv - Developmental Biology 2022Quote: ... We performed qPCR using the TB Green Premix Ex Taq II (RR820; Takara) and CFX96 Real-Time System (Bio-Rad ...
-
bioRxiv - Microbiology 2021Quote: ... Real-time PCR was performed using SYBR Premix Ex Taq II (TaKaRa, RR820A) on LightCycler96 qPCR system (Roche) ...
-
bioRxiv - Immunology 2020Quote: ... qRT-PCR was performed using TB Green TM Premix Ex TaqTM II (Takara). The following was the reaction system ...
-
bioRxiv - Microbiology 2020Quote: ... cDNA was synthesize from the extracted RNA using PrimeScriptScript II reverse transcriptase (Takara) and random primers ...
-
bioRxiv - Developmental Biology 2022Quote: ... cDNA was synthesized with the PrimeScript II 1st strand synthesis kit (Takara bio). RT-qPCR was performed with CFX connect (Bio-Rad ...
-
bioRxiv - Cell Biology 2019Quote: ... containing 5 μL of 2× SYBR Premix Ex Taq II (TaKaRa, Beijing, China), 1 μL of cDNA ...
-
bioRxiv - Cell Biology 2019Quote: ... The SYBR® Premix Ex Taq TM II kit (Takara, Beijing, China, RR82LR) reagent was used to detect the expression of miR195 by real-time quantitative PCR using the Applied Biosystems 7500 Real-Time PCR System (Thermo ...
-
bioRxiv - Molecular Biology 2020Quote: ... Quantitative RT-PCR was performed using TB Green Premix Ex Taq II (Takara). Relative gene expression was normalized to ACTB expression ...
-
bioRxiv - Molecular Biology 2021Quote: ... The isolated RNAs were reverse-transcribed using PrimeScript II reverse transcriptase (Takara Bio) with SP6 primer ...
-
bioRxiv - Developmental Biology 2019Quote: ... and cDNA was synthesized using the PrimeScript II cDNA synthesis kit (TaKaRa 6210). The qPCR reaction mixtures were prepared with SYBR FAST qPCR master mix (KAPA KR0389) ...
-
bioRxiv - Bioengineering 2019Quote: ... SYBR® Premix Ex Taq™ II (Takara Bio Inc., Kusatsu, Shiga, Japan), and custom-designed qRT-PCR primers (Table S1 ...
-
bioRxiv - Genetics 2021Quote: ... or using SYBR Premix Ex Taq II (Tli RNase H Plus) (Takara Bio) on a LightCycler 480 II (Roche) ...
-
bioRxiv - Evolutionary Biology 2021Quote: ... with TB Green® Premix Ex Taq™ II (Tli RNaseH Plus, Takara). The cycling conditions were as follows ...
-
bioRxiv - Developmental Biology 2020Quote: ... Real-time PCR was performed using SYBR Premix Ex Taq II (Takara Bio) on an ABI 7500 Real-Time PCR system (Applied Biosystems) ...
-
bioRxiv - Microbiology 2022Quote: ... and amplification was performed using the SYBR Premix Ex Taq II (Takara, Japan) solution ...
-
bioRxiv - Cell Biology 2022Quote: ... qPCR analyses were performed using SYBR Premix Ex Taq™ II (Takara, RR820L) and samples were run on the ABI HT7900 platform (Applied Biosystems) ...
-
bioRxiv - Plant Biology 2022Quote: ... and TB Green® Premix Ex Taq™ II (Tli RNaseH Plus) (TaKaRa) with Thermal cycler (CFX96 ...