Labshake search
Citations for Takara Bio :
401 - 450 of 515 citations for Recombinant Cynomolgus CD3E & CD3D His Fc & Flag Fc tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2023Quote: ... by dispensing individual cells in 5 nL drops directly into 3 µL ice-cold single cell lysis buffer (scLB, 0.134% Triton X-100 [Sigma], 0.5 U/µL recombinant RNase inhibitor [Takara, 2313B] ...
-
bioRxiv - Immunology 2023Quote: ... 0.6% NP-40 and freshly added 1mM DTT) supplemented with 0.2U/µl recombinant RNase Inhibitor (Takara, Catalog # 2313B) and incubated for 5 minutes on ice ...
-
bioRxiv - Molecular Biology 2020Quote: ... and ligated into the Nhe1 site of the pBS32-Flag-MS2CP parent plasmid using InFusion cloning (Clontech). The PTBP1 Y247Q ...
-
bioRxiv - Genomics 2020Quote: ... with a flag tag at the N terminal and an EGFP tag at the C terminal by the In-Fusion HD Cloning system (TaKaRa, 638909). After transfection of the U2OS cells with the pCMV-Tet3G Vector ...
-
bioRxiv - Biochemistry 2022Quote: ... encoding a KkRseP derivative having an internal PA14 tag: Lys54-EGGVAMPGAEDDVV-His55) was constructed by using the In-Fusion HD Cloning Kit (Takara Bio) as follows ...
-
bioRxiv - Neuroscience 2019Quote: ... and then in primary antibodies in PBST at 4°C for 48 hours using rabbit anti-DsRed (mCherry tag; 1:500; Clontech; 632496), and mouse anti-Th (1:1,000 ...
-
bioRxiv - Cell Biology 2022Quote: ... Donor vectors containing the GFP or mKate2 coding sequence flanked by 1kb homology arms adopted from both 3′ and 5′ sides of the insertion site were generated by cloning of PCR-amplified tags and arms into linearized pGEM-3z vector by In-Fusion HD Cloning Kit (Takara Bio). Obtained gRNA expression plasmids and donor plasmids were injected into the y w embryos with a final concentration of 120 ng/ul for each ...
-
bioRxiv - Cell Biology 2022Quote: ... ACLY lentivirus constructs were generated by inserting ACLY variants with an N-terminal MYC tag into pLVX-IRES-Puro (Clontech, 632183). All DNA constructs were verified by Sanger sequencing.
-
bioRxiv - Immunology 2022Quote: ... and the transmembrane domain replaced with a GCN448 or foldon trimerization49 domain followed by an Avi-Tag50 and a hexahistidine tag was cloned into a mammalian expression vector (pADD2) by In-Fusion (Takara Bio). Similarly ...
-
bioRxiv - Microbiology 2023Quote: ... the V5-tag sequence followed by a Stop codon was introduced upstream of the IRES in the pLVX-IRES-Neo vector (Clontech, Addgene), using annealed oligo-cloning ...
-
bioRxiv - Biochemistry 2023Quote: ... 425 – 658) and SipAC-Core (a.a. 512 – 658) were cloned with an N-terminal 6xHis-tag into pColdI vector (Takara Bio USA) modified to include a tobacco etch virus (TEV ...
-
bioRxiv - Biochemistry 2024Quote: ... The recombinant SMC1A HD/RAD21C and SMC3 HD/RAD21N protein complexes were then purified by affinity chromatography using the 10xHis purification tag on RAD21 by incubating the cleared lysates with TALON Metal Affinity Resin (Takara Bio). The purification tag was then removed on the affinity beads by overnight 3C protease digestion at 4°C ...
-
bioRxiv - Microbiology 2021Quote: ... at 30°C for 3-5 days and assayed for growth on the SD/-Trp/-Leu/-His/-Ade/X-α-gal plates (TaKaRa Bio). Each experiment was repeated at least three times.
-
bioRxiv - Neuroscience 2022Quote: ... double-stranded cDNA whole transcriptome library was synthesized from 1µg of total RNA with Takara Bio’s SMARTer Stranded Total RNA Sample Prep Kit – HI Mammalian (Takara Bio, Cat. No. 634876) and SMARTer RNA Unique Dual Index Kit (Takara Bio ...
-
bioRxiv - Neuroscience 2020Quote: ... this was followed by a second screening using the SD quadruple dropout (Leu−, Trp−, Ade−, and His−) selective medium (Clontech Takara Bio). After the elimination of duplicates containing the same AD/library plasmid via yeast-colony PCR ...
-
bioRxiv - Plant Biology 2020Quote: ... and LacZ reporter genes was examined with yeast AH109 transformants on SD/−Trp/−His and SD/−Trp/−Ade media (Clontech Inc., USA). The fix composition of SD plates contained 0.17 g yeast nitrogen base (YNB) ...
-
bioRxiv - Plant Biology 2023Quote: ... and on a SD-Leu-Trp-Ade-His plate containing X-α-gal and supplemented with 0.2 µg/ml Aureobasidin A (Takara Bio, USA). Plates were imaged after incubation for 60–72 hr at 30 °C ...
-
bioRxiv - Neuroscience 2020Quote: ... each well of the lysis plates contained 0.4 μL lysis buffer [0.5 U Recombinant RNase Inhibitor (Takara Bio, 2313B), 0.0625% Triton X-100 (Sigma ...
-
bioRxiv - Microbiology 2022Quote: The recombinant pGBKT7-TaPHB-1 was transformed into Y2HGold yeast strain following the Yeastmaker Yeast Transformation System 2 (TaKaRa). The transformants were screened on SD/-Trp agar plate ...
-
bioRxiv - Microbiology 2019Quote: ... The Pfc43opt recombinant protein was soluble and purified by cobalt affinity chromatography using TALON® metal affinity resin (Takara) under native conditions in phosphate buffered saline (PBS) ...
-
bioRxiv - Biochemistry 2022Quote: The recombinant protein in the soluble fraction was then purified using TALON Metal Affinity Resin (Clontech Laboratories, CA, USA) per manufacturer’s protocol ...
-
bioRxiv - Cancer Biology 2022Quote: ... the recombinant pAAV-CRE plasmid was packaged in HEK293T cells using pHelper and pRC2-mi342 plasmids (Takara, Catalog #632608). Cells were harvested three days after transfection and AAV2 was isolated using AAVpro Extraction Solution (Takara ...
-
bioRxiv - Immunology 2022Quote: ... Recombinant adenovirus vaccines were produced using the Adeno-X™ Adenoviral System 3 according to the manufacturer’s manual (Takara Korea Biomedical Inc. ...
-
bioRxiv - Microbiology 2022Quote: ... The recombinant adenovirus was prepared in HEK293 cells and purified with an Adeno-X Virus Purification kit (Takara Bio). The purified virus titer was determined using an Adeno-X Rapid Titer kit (Takara Bio) ...
-
bioRxiv - Genomics 2023Quote: ... The recombinant pAAV-CRE plasmid was packaged in HEK293T cells using pHelper and pRC2-mi342 plasmids (Takara, Catalog #632608). Cells were harvested three days after transfection and AAV2 was isolated using AAVpro Extraction Solution (Takara ...
-
bioRxiv - Neuroscience 2024Quote: ... After the addition of 5 µl lysis buffer (0.2% Triton X-100, with 2 U/μl recombinant RNase inhibitor, Clontech) to the cap ...
-
bioRxiv - Microbiology 2020Quote: ... The PCR product was then cloned into the BG1861 vector by ligation-independent cloning to introduce a N-terminal 6xHis tag and transformed into Stellar™ chemically competent cells (Clontech Laboratories) for plasmid propagation (84) ...
-
bioRxiv - Biochemistry 2022Quote: ... using SARS-CoV-2 S as template and subcloned into pcDNA3.3 vector with a C-terminal hexahistidine tag using In-Fusion cloning technology (Takara Bio USA, Inc.). RBD of SARS-CoV S was cloned into pcDNA3.3 vector from pcDNA3.1-SARS-Spike (Addgene plasmid#145031) ...
-
bioRxiv - Plant Biology 2022Quote: ... The PCR fragment containing the SHHc tag was combined with the digested backbone using In-Fusion HD cloning (Clontech, Mountain View, California) to make pK7-SHHc ...
-
bioRxiv - Immunology 2023Quote: ... Genomic DNA samples from the patients’s paired tumor tissues and WBCs were used to prepare DNA libraries for DNA sequencing with the ThruPLEX Tag-seq Kit (Takara Bio, USA). The libraries were then pooled and hybridized with pre-designed probes for 95 targeted genes (Integrated DNA Technologies ...
-
bioRxiv - Cancer Biology 2023Quote: ... Genomic DNA samples from the patients’s paired tumor tissues and WBCs were used to prepare DNA libraries for DNA sequencing with the ThruPLEX Tag-seq Kit (Takara Bio, USA). The libraries were then pooled and hybridized with pre-designed probes for 95 targeted genes (Integrated DNA Technologies ...
-
bioRxiv - Developmental Biology 2024Quote: ... the C-terminal twin strep tag was removed by incubating with the 3C protease (Takara Bio, Japan; 1.5 unit/50 mg protein) and ran on a size-exclusion column ...
-
bioRxiv - Neuroscience 2022Quote: ... with either 7.5 μg of pcDNA3.1 and pcDNA3.1-p27-Flag (p27 full-length construct) or 7.5 μg of empty pMSCVpuro (Clontech, 634401) and pSUPER.retro mSox2.3 (shRNASox2 target sequence ...
-
bioRxiv - Immunology 2020Quote: ... The IFIT1 amplicon was inserted into the NotI-PmeI digested pEF-Tak-Flag vector by InFusion cloning (Clontech). The following 5’UTR constructs were purchased from IDT as gBlocks ISG15 (RefSeq ...
-
bioRxiv - Microbiology 2021Quote: ... the cells were transfected with eukaryotic expression plasmid harbouring FLAG or MYC-tagged FBXO22 using Xfect (TAKARA Bio) transfection reagent according to manufacturer’s instructions ...
-
Actin binding domain of Rng2 sparsely bound on F-actin strongly inhibits actin movement on myosin IIbioRxiv - Biophysics 2022Quote: ... which had a TEV protease recognition sequence between the 6×His sequence and the multiple cloning site of pColdI (Takara Bio, Kusatsu, Japan). The amino acid sequence of His-TEV Rng2CHD was MNHKVHHHHHHIEGRHMENLYFQGTLEGSEFKLDVNVGL…(Rng2CHD)…LPNFKA ...
-
bioRxiv - Synthetic Biology 2020Quote: Yeast with the uracil auxotrophy were cultivated in complete synthetic media without uracil prepared with -His-Ura dropout supplement (Clontech, Mountain View, CA) according to manufacturer’s instructions and supplemented with 20 g/mL histidine and 80mg/L adenine hemisulfate (Sigma-Aldrich ...
-
bioRxiv - Biophysics 2019Quote: ... cells bearing the corresponding plasmids and were purified according to.63 Partially purified lysates were loaded onto equilibrated cobalt His-TALON columns (Clontech, Mountain View, CA). The column was washed with 40 to 50 volumes of wash buffer (50 mM NaH2PO4 ...
-
bioRxiv - Plant Biology 2022Quote: ... and impact of SAID1/SAID2 on SE interaction with other proteins was examined on SD-His/-Leu/-Met/-Trp quadruple dropout medium (Clontech, Cat. No. 630429) supplemented with 5 mM 3-amino-1,2,4-triazole (3-AT ...
-
bioRxiv - Neuroscience 2023Quote: ... LRP10 sequence-verified cDNA was subcloned from the pcDNA™3.1-LRP10-V5-His-TOPO® plasmid described previously (9) into the pLVX-EF1α-IRES-mCherry plasmid (Takara Bio, 631987). Briefly ...
-
bioRxiv - Neuroscience 2023Quote: ... LRP10 sequence-verified cDNA was subcloned from the pcDNA™3.1-LRP10-V5-His-TOPO® plasmid (Quadri et al., 2018) into the pLVX-EF1α-IRES-mCherry plasmid (Takara Bio, 631987) via Gibson Assembly® (NEB ...
-
bioRxiv - Plant Biology 2020Quote: ... The cDNA library was ligated to pGADT7-Rec vector to prepare recombinant AD construct using Make Your Own “Mate and Plate” Library system (Clontech). The yeast strain Y2H gold was co-transformed with bait and prey recombinant construct and colonies were screened against DDO (SD/-Leu/-Trp ...
-
bioRxiv - Plant Biology 2019Quote: 6His-GST-CRK2cyto and 6His-MBP-RBOHD/C constructs for recombinant proteins were generated by using In-Fusion technology (Clontech). The coding regions of CRK2cyto (WT ...
-
bioRxiv - Molecular Biology 2021Quote: ... sperm from 15 flies were dissected and pooled in 1:10 dilution of RNAse inhibitor (Recombinant ribonuclease inhibitor 5 000 U, Cat. 2313A Takara), and samples were flash-frozen on dry-ice ...
-
bioRxiv - Neuroscience 2020Quote: ... Single cells were sorted into 96-well plates containing 4uL lysis buffer containing 4U Recombinant RNase Inhibitor (Takara Bio 2313B), 0.05% Triton X-100 ...
-
bioRxiv - Neuroscience 2020Quote: Cultured rat cortical neurons were infected with recombinant lentiviruses at DIV3 and harvested at DIV10 for qRT-PCR using SYBR green qPCR master mix (Takara). Total RNA was extracted from rat cortical neurons using the TRIzol reagent (Invitrogen ...
-
bioRxiv - Neuroscience 2020Quote: Cultured rat cortical neurons were infected with recombinant lentiviruses at DIV4 and harvested at DIV11 for qRT-PCR using SYBR green qPCR master mix (TaKaRa). Total RNA was extracted from mouse cortical neurons using TRIzol reagent (Invitrogen ...
-
bioRxiv - Systems Biology 2021Quote: ... for about 60 minutes at 37°C and sorted into lysis buffer (4μl 0.5 U/μL Recombinant RNase Inhibitor (Takara Bio, 2313B), 0.0625% Triton X-100 (Sigma ...
-
bioRxiv - Microbiology 2022Quote: ... cells were transduced in 24-well plates precoated with recombinant fibronectin (FN CH-296, Retronectin Takara, Clontech, Mountain View, CA) with retroviral supernatants and expanded in complete medium (45% RPMI-1640 and 45% Click’s medium ...
-
bioRxiv - Microbiology 2022Quote: ... cells were transduced in 24-well plates precoated with recombinant fibronectin (FN CH-296, Retronectin Takara, Clontech, Mountain View, CA) with retroviral supernatants and expanded in complete medium (45% RPMI-1640 and 45% Click’s medium ...