Labshake search
Citations for Takara Bio :
401 - 450 of 737 citations for Human Chemokine Like Factor Superfamily 6 CKLFSF6 Protein since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2022Quote: ... Viral supernatant was harvested 48 h after transfection and added to 6 well plates that had been precoated with 15 μg/ml RetroNectin (Takara Bio Inc.) and blocked with 2% BSA ...
-
bioRxiv - Immunology 2020Quote: ... Cells were counted and seeded at 3 million cells in 1 mL of media with 2x hIL-2 into each well of a 6 well plate that was coated with 15 µg/mL of RetroNectin (Takara, Cat# T100A) for 3 hours at room temperature and subsequently washed with 1x PBS ...
-
bioRxiv - Molecular Biology 2021Quote: ... was co-transformed with GAL4 DNA-BD-fused IPMK and a human brain cDNA activation domain (AD) library (Clontech). Two different reporter genes (HIS3 and ADE2 ...
-
bioRxiv - Neuroscience 2020Quote: ... we used Sanger sequencing of cDNA reverse transcribed from pooled human hippocampus poly-A-selected RNA (Takara/Clontech 636165) to support the presence of the human-specific intron-3 retention event identified within APOE (GRCh38 ...
-
bioRxiv - Neuroscience 2020Quote: ... we used Sanger sequencing of cDNA reverse transcribed from pooled human hippocampus poly-A-selected RNA (Takara/Clontech 636165) to support the presence of the human-specific intron-3 retention event identified within APOE (GRCh38 ...
-
bioRxiv - Cell Biology 2021Quote: ... Gene expression profiles of mature hepatocytes were analyzed using human liver total RNA (636531, Clontech: Takara Bio, Shiga, Japan). Expression profiles of bile duct epithelial cells were obtained from Gene Expression Omnibus (GSM4454532 ...
-
bioRxiv - Cell Biology 2021Quote: ... Gene expression profiles of mature hepatocytes were analyzed using human liver total RNA (636531, Clontech: Takara Bio, Shiga, Japan). Expression profiles of bile duct epithelial cells were obtained from Gene Expression Omnibus (GSM4454532 ...
-
bioRxiv - Biophysics 2022Quote: Experiments were performed using PtK2 GFP-α-tubulin cells (stable line expressing human α-tubulin in pEGFP-C1, Clontech Laboratories ...
-
bioRxiv - Genomics 2022Quote: ... IgG and IgM 5’RACE AIRR-seq libraries were generated using the SMARTer Human BCR Profiling Kit (Takara Bio), following the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2019Quote: Human PDE4D5 wild type and PDE4D5-dN mutant were PCR amplified and cloned into pLVX-mCherry-N1 vector (Clontech) using Gibson assembly after vector digestion with XhoI and EcoRI ...
-
bioRxiv - Cell Biology 2020Quote: EGFP-Rab5 construct was generated by PCR amplifying human Rab5a from cDNA and subcloning into the pEGFP-C2 (Clontech) vector using XhoI/BamHI restriction sites ...
-
bioRxiv - Microbiology 2019Quote: ... Sequences encoding primate PBMs were added to the resulting pDONR221-mCherry-human GBP1DC_BglII vector following BglII digestion using Ligation-Independent cloning (In-Fusion, Clontech) with annealed oligomers that also restored human GBP1 Q580-L581 and the human GBP1 CaaX box (Table S9) ...
-
bioRxiv - Biophysics 2021Quote: ... PCR products were cloned into vector pcDNA3.3 (Thermo Fischer Scientific) for human IgG1 expression using In-Fusion cloning technology (Clontech) as described previously[1] ...
-
bioRxiv - Immunology 2021Quote: ... Antibodies were produced by transient transfection of human epithelium kidney 293T Lenti-X cells (Clontech Laboratories, Mountain View, CA) using the JetPrime transfection kit (Polyplus Transfection Illkirch ...
-
bioRxiv - Molecular Biology 2021Quote: ... Human eRF1 coding sequence was cloned into the XhoI and HindIII sites of the pλN-HA-C1 vector (Clontech). The pλN-HA-C1-eRF1 plasmid was then used to generate the pλN-HA-C1-eRF1AAQ (G183A G184A ...
-
bioRxiv - Cell Biology 2021Quote: ... US) and human cervical adenocarcinoma cells expressing a tetracycline-inducible repressor (HeLa Tet-Off, Clontech, Mountain View, California, US) were cultured in Dulbecco’s Modified Eagle Medium (DMEM ...
-
bioRxiv - Biophysics 2021Quote: The EGFR-GFP plasmid was constructed using the cDNA of human EGFR (pNeoSRαII) provided by Akihiko Yoshimura (Keio University) and was inserted into the pEGFP-C1 vector (Clontech) with the same linker sequence suggested by Carter and Sorkin (Carter and Sorkin ...
-
bioRxiv - Genomics 2023Quote: 200ng of RNA extracted from whole human blood used as input for reverse transcription using Smartscribe RT (Takara Clontech) with primers targeting the IGH constant regions (IDT ...
-
bioRxiv - Genomics 2023Quote: 200ng of RNA extracted from whole human blood used as input for reverse transcription using Smartscribe RT (Takara Clontech) with primers targeting the IGH constant regions (IDT ...
-
bioRxiv - Cancer Biology 2023Quote: ... Individual lentiCRISPRv2 vectors were introduced along with packaging vectors into human embryonic kidney (HEK) 293T cells via calcium phosphate transfection according to the manufacturer’s protocol (Clontech). Lentivirus was harvested at 48 and 72 hours after transfection in RPMI media supplemented with 10% FBS and filtered with 45 μm filters prior to transduction of cancer cell lines using centrifugation at 1000 g for 2 hours in the presence of 8 μg/mL of polybrene (Santa Cruz Biotechnology) ...
-
bioRxiv - Cell Biology 2023Quote: ... Gene expression profiles of mature hepatocytes were analyzed using human liver total RNA (636531, Clontech: Takara Bio, Shiga, Japan).
-
bioRxiv - Cell Biology 2023Quote: ... Gene expression profiles of mature hepatocytes were analyzed using human liver total RNA (636531, Clontech: Takara Bio, Shiga, Japan).
-
bioRxiv - Biophysics 2019Quote: ... the detergent-solubilised protein were batch bound to Co2+-charged Talon resin (Clontech) by gentle rotation at 4 °C for 1 h ...
-
bioRxiv - Systems Biology 2021Quote: ... the inducible fluorescent protein was induced by adding 1 μg/ml doxycycline (Clontech) alone or together with 100 nM rapamycin (Harveybio ...
-
bioRxiv - Neuroscience 2021Quote: ... the fluorescent proteins were amplified from pAM FLEX eGFP and pmCherry-C1 (Clontech) respectively ...
-
bioRxiv - Cell Biology 2021Quote: ... 6xHis tagged proteins were purified using Talon Co2+ affinity resin (Takara Bio, USA) and eluted with 150 mM Imidazole in the lysis buffer pH 7.8 ...
-
bioRxiv - Microbiology 2021Quote: ... The protein bands were visualized using the Western BLoT Hyper HRP Substrate (TAKARA) and exposed using a Chemiluminescence Imaging System (Fusion Solo S ...
-
bioRxiv - Cell Biology 2022Quote: Every protein expressed in mouse rods was also cloned into pEGFP-N1 (Clontech) for expression in AD293 cells using the AgeI and NotI cloning sites within the vector to replace EGFP with the tagged proteins ...
-
bioRxiv - Plant Biology 2020Quote: ... Transferred proteins were first probed with anti-GFP (Takara Bio, 1:5,000 dilution) for 16 h ...
-
bioRxiv - Biochemistry 2021Quote: ... The recombinant proteins were purified with His60 Ni Gravity Column Purification Kit (Clontech) following a manufacturer’s protocol ...
-
bioRxiv - Biochemistry 2019Quote: ... the Rab8A proteins were co-expressed with the chaperone GroEL/S (pGro7, Takara). The expression of the GroEL/S chaperone was auto-induced by supplementing the LB-medium with 1 mg/mL arabinose.
-
bioRxiv - Biochemistry 2021Quote: ... Proteins in the supernatant were purified by the affinity chromatography with TALON (Clontech) resin ...
-
bioRxiv - Cell Biology 2020Quote: ... Shield-1 ligand for stabilization of DD-tagged proteins was purchased from Takara Bio (Cat # 632189 ...
-
bioRxiv - Molecular Biology 2023Quote: ... Monoclonal U-2OS cell lines stably expressing Tet-On 3G transactivator protein (Clontech), a tandem-dimeric MS2 hairpin binding protein tagged with eYFP (MS2CP-YFP) ...
-
bioRxiv - Cell Biology 2023Quote: For mammalian expression of eGFP labelled proteins we used the pEGFP-C1 (Clontech) vector ...
-
bioRxiv - Developmental Biology 2023Quote: ... which was induced for protein purification using Talon Metal Affinity Resin (Takara 635501). Two New Zealand white rabbits were injected at ten sites with 500μl of Freund’s Complete Adjuvant (Sigma-Aldrich F5881 ...
-
bioRxiv - Biochemistry 2023Quote: ... MA) and the protein was purified using Talon beads (Takara Bio Inc., Japan) following published protocols 37,38 ...
-
bioRxiv - Cell Biology 2023Quote: ... for GST-tagged protein or on TALON-Cobalt beads column (635507, Takara Bio) for 6XHIS-tagged protein as previously described [19,26] ...
-
bioRxiv - Neuroscience 2023Quote: ... the fluorescent proteins were amplified from pAM FLEX eGFP and pmCherry-C1 (Clontech) respectively ...
-
bioRxiv - Plant Biology 2024Quote: ... The JMJ27-GFP fusion protein was detected using the anti-GFP (Takara: 632593) 1:2,000 (v ...
-
bioRxiv - Microbiology 2024Quote: ... The fusion protein was affinity-purified using TALON metal affinity resin (Takara Biosciences) and eluted in buffer containing 50 mM Tris-HCl ...
-
Actin binding domain of Rng2 sparsely bound on F-actin strongly inhibits actin movement on myosin IIbioRxiv - Biophysics 2022Quote: ... which had a TEV protease recognition sequence between the 6×His sequence and the multiple cloning site of pColdI (Takara Bio, Kusatsu, Japan). The amino acid sequence of His-TEV Rng2CHD was MNHKVHHHHHHIEGRHMENLYFQGTLEGSEFKLDVNVGL…(Rng2CHD)…LPNFKA ...
-
bioRxiv - Neuroscience 2019Quote: ... and 96 hours post transfection viral particle containing supernatants were harvested and filtered through a 0.45μm PES syringe filter (Membrane Solutions, Cat. Nr. SFPES030045S) followed by a 6-fold concentration using Lenti-X-Concentrator (Clontech, Cat. Nr. 631232) according to the manufacturer’s instructions.
-
bioRxiv - Molecular Biology 2020Quote: ... cells were cultured at a density of 1 × 106 per well in a 6 well dish and the cell number was counted daily under microscopy using trypan blue staining (Takara, Japan. Cat# Y50015). Cells were also seeded at a low density in 96 well plate (5000 cells per well ...
-
bioRxiv - Cell Biology 2020Quote: ... at the C-terminus were amplified by PCR using KOD-Plus-Neo polymerase (Toyobo) and Human Universal QUICK-Clone cDNA II (Clontech) for a template cDNA and then cloned into a pET-41 Ek/LIC vector (Novagen) ...
-
bioRxiv - Developmental Biology 2021Quote: ... The guide RNA was designed to target an immediate downstream of the stop codon of the human GATA3 gene and generated using the Guide-it sgRNA In Vitro Transcription System (Clontech). The target sequences of gRNAs are shown in Table S2 ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: ... mtDNA copy number was determined by quantitative PCR with Human mitochondrial to nuclear DNA ratio kit (Takara Bio USA, 7246).
-
bioRxiv - Molecular Biology 2021Quote: ... cDNA fragment of human METTL18 with a C-terminal HA sequence was cloned into AgeI and EcoRI sites of the pQCXIP vector (Clontech). To generate hMETTL18-Asp193Lys-Gly195Arg-Gly197Arg-HA ...
-
bioRxiv - Immunology 2020Quote: ... Transient retroviral supernatants were produced as previously described.44 Activated NK cells were purified and transduced with retroviral supernatants on day +4 in human fibronectin-coated plates (Clontech Laboratories ...
-
bioRxiv - Biochemistry 2019Quote: ... 5’UTRs of MAGED2 TV2 and TV3 were amplified by RT-PCR from RNA isolated from human testes tissue purchased from Takara Bio (Mountain View ...