Labshake search
Citations for Takara Bio :
501 - 550 of 2767 citations for Cell Division Cycle 2 Like Protein Kinase 6 CDC2L6 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Evolutionary Biology 2023Quote: ... which were carried out by Advantage® 2 Polymerase (Takara Bio). Final products were outsourced for Sanger sequencing (HyLabs ...
-
Targeted Perturb-seq Reveals EGR1 and FOS as Key Regulators of the Transcriptional RAF-MAPK ResponsebioRxiv - Systems Biology 2024Quote: ... 1x Titanium Taq buffer and 2 μL Titanium Taq polymerase (Takara) were mixed in 50 µL total volume ...
-
bioRxiv - Microbiology 2020Quote: ... primary antibody was prepared in PBS containing 1% non-fat milk using anti-hexahistidine antibody (Takara Bio, catalog #631212) at a dilution of 1:3000 ...
-
bioRxiv - Biophysics 2019Quote: ... the detergent-solubilised protein were batch bound to Co2+-charged Talon resin (Clontech) by gentle rotation at 4 °C for 1 h ...
-
bioRxiv - Systems Biology 2021Quote: ... the inducible fluorescent protein was induced by adding 1 μg/ml doxycycline (Clontech) alone or together with 100 nM rapamycin (Harveybio ...
-
bioRxiv - Neuroscience 2021Quote: ... the fluorescent proteins were amplified from pAM FLEX eGFP and pmCherry-C1 (Clontech) respectively ...
-
bioRxiv - Cell Biology 2021Quote: ... 6xHis tagged proteins were purified using Talon Co2+ affinity resin (Takara Bio, USA) and eluted with 150 mM Imidazole in the lysis buffer pH 7.8 ...
-
bioRxiv - Microbiology 2021Quote: ... The protein bands were visualized using the Western BLoT Hyper HRP Substrate (TAKARA) and exposed using a Chemiluminescence Imaging System (Fusion Solo S ...
-
bioRxiv - Cell Biology 2022Quote: Every protein expressed in mouse rods was also cloned into pEGFP-N1 (Clontech) for expression in AD293 cells using the AgeI and NotI cloning sites within the vector to replace EGFP with the tagged proteins ...
-
bioRxiv - Plant Biology 2020Quote: ... Transferred proteins were first probed with anti-GFP (Takara Bio, 1:5,000 dilution) for 16 h ...
-
bioRxiv - Biochemistry 2021Quote: ... The recombinant proteins were purified with His60 Ni Gravity Column Purification Kit (Clontech) following a manufacturer’s protocol ...
-
bioRxiv - Biochemistry 2019Quote: ... the Rab8A proteins were co-expressed with the chaperone GroEL/S (pGro7, Takara). The expression of the GroEL/S chaperone was auto-induced by supplementing the LB-medium with 1 mg/mL arabinose.
-
bioRxiv - Biochemistry 2021Quote: ... Proteins in the supernatant were purified by the affinity chromatography with TALON (Clontech) resin ...
-
bioRxiv - Cell Biology 2020Quote: ... Shield-1 ligand for stabilization of DD-tagged proteins was purchased from Takara Bio (Cat # 632189 ...
-
bioRxiv - Cell Biology 2023Quote: ... for GST-tagged protein or on TALON-Cobalt beads column (635507, Takara Bio) for 6XHIS-tagged protein as previously described [19,26] ...
-
bioRxiv - Cell Biology 2023Quote: For mammalian expression of eGFP labelled proteins we used the pEGFP-C1 (Clontech) vector ...
-
bioRxiv - Developmental Biology 2023Quote: ... which was induced for protein purification using Talon Metal Affinity Resin (Takara 635501). Two New Zealand white rabbits were injected at ten sites with 500μl of Freund’s Complete Adjuvant (Sigma-Aldrich F5881 ...
-
bioRxiv - Biochemistry 2023Quote: ... MA) and the protein was purified using Talon beads (Takara Bio Inc., Japan) following published protocols 37,38 ...
-
bioRxiv - Neuroscience 2023Quote: ... the fluorescent proteins were amplified from pAM FLEX eGFP and pmCherry-C1 (Clontech) respectively ...
-
bioRxiv - Plant Biology 2024Quote: ... The JMJ27-GFP fusion protein was detected using the anti-GFP (Takara: 632593) 1:2,000 (v ...
-
bioRxiv - Microbiology 2024Quote: ... The fusion protein was affinity-purified using TALON metal affinity resin (Takara Biosciences) and eluted in buffer containing 50 mM Tris-HCl ...
-
Actin binding domain of Rng2 sparsely bound on F-actin strongly inhibits actin movement on myosin IIbioRxiv - Biophysics 2022Quote: ... which had a TEV protease recognition sequence between the 6×His sequence and the multiple cloning site of pColdI (Takara Bio, Kusatsu, Japan). The amino acid sequence of His-TEV Rng2CHD was MNHKVHHHHHHIEGRHMENLYFQGTLEGSEFKLDVNVGL…(Rng2CHD)…LPNFKA ...
-
bioRxiv - Neuroscience 2019Quote: ... and 96 hours post transfection viral particle containing supernatants were harvested and filtered through a 0.45μm PES syringe filter (Membrane Solutions, Cat. Nr. SFPES030045S) followed by a 6-fold concentration using Lenti-X-Concentrator (Clontech, Cat. Nr. 631232) according to the manufacturer’s instructions.
-
bioRxiv - Immunology 2021Quote: ... The following primary antibodies were used in this study: Living colors DsRed Polyclonal antibody (Rabbit, 1:300, Takara Bio #632496); FITC Anti-mouse Ki67 (1:100 ...
-
bioRxiv - Cell Biology 2022Quote: ... The samples were subjected to 4-20% SDS-PAGE and analyzed by immunoblotting with the following primary antibodies: anti-GFP mouse monoclonal antibody (JL-8, Takara), GFP rabbit polyclonal antibody (PABG1 ...
-
bioRxiv - Bioengineering 2023Quote: HEK293 cells (DMSZ) and HEK293T cells (Takara) were maintained in Dulbecco’s modified Eagle’s medium (DMEM ...
-
bioRxiv - Immunology 2019Quote: ... rabbit anti-DsRed polyclonal antibody (1:500; Clontech), Alexa Fluor 488-conjugated anti-chicken IgG antibody (1:500 ...
-
bioRxiv - Cell Biology 2019Quote: ... The anti-GFP antibody was purchased from Clontech. The anti-CPY and anti-Pgk1 antibodies were from Molecular Probes ...
-
bioRxiv - Biochemistry 2020Quote: ... HA-tag polyclonal Antibody (631207) was from Clontech.
-
bioRxiv - Microbiology 2020Quote: ... then incubated with antibody against c-Myc (Clontech) in lysis buffer ...
-
bioRxiv - Neuroscience 2022Quote: ... and mouse anti-mCherry antibodies (Clontech; 1:2000) in PBST-azide with 3% NDS ...
-
bioRxiv - Microbiology 2022Quote: ... Western blots using Anti-His primary antibody (Clontech) (1:4000 dilution ...
-
bioRxiv - Neuroscience 2021Quote: ... rabbit anti-DsRed antibodies (1:3000, Takara, 632496). Sections were washed three times in PBS ...
-
bioRxiv - Neuroscience 2021Quote: ... Primary antibodies used: DsRed (Rabbit, 1:2000, Clontech), VGLUT1 (Guinea Pig ...
-
bioRxiv - Plant Biology 2022Quote: ... anti-GFP monoclonal antibody JL-8 (632381, Clontech) was used at 1/3000 ...
-
bioRxiv - Immunology 2022Quote: ... rabbit anti-DsRed polyclonal antibody (1:500; Clontech), rabbit anti-Lcp1 (1:1000) ...
-
bioRxiv - Cell Biology 2019Quote: ... The antibody against GFP (polyclonal) was from Takara Bio Inc ...
-
bioRxiv - Molecular Biology 2019Quote: ... or a mouse α-GFP antibody (632381, Takara) to a dilution of 1:2000 in Odyssey Blocking Buffer (PBS ...
-
bioRxiv - Developmental Biology 2020Quote: ... rabbit anti-DsRed polyclonal antibody (1:500; Clontech), Alexa Fluor 488-conjugated anti-chicken IgG antibody (1:500 ...
-
bioRxiv - Molecular Biology 2021Quote: The sources of the antibodies were: GFP (Clontech); GAPDH ...
-
bioRxiv - Neuroscience 2021Quote: ... hNSC antibody (SC121, 1:100; Takara: Cat #: Y40410) and vGlut 1 (vesicular glutamate transporter 1 ...
-
bioRxiv - Neuroscience 2021Quote: ... and mouse anti-mCherry antibodies (Clontech; 1:2000) in PBST-azide with 3% normal donkey serum ...
-
bioRxiv - Molecular Biology 2022Quote: ... 6xHN Polyclonal Antibody (1:2000, Takara, CA, USA) at 4°C for overnight ...
-
bioRxiv - Microbiology 2023Quote: ... GFP tag (JL-8 monoclonal antibody from Takara), and mCherry (polyclonal antibody from Thermo Fisher ...
-
bioRxiv - Plant Biology 2023Quote: ... and a rabbit LexA binding domain antibody (Clontech), respectively.
-
bioRxiv - Cancer Biology 2023Quote: ... Antibodies against E-cadherin (clone ECCD2 Takara, M108), c-Jun (CST #9165) ...
-
bioRxiv - Cell Biology 2023Quote: ... an antibody to GFP was obtained from Takara Bio (Saint-Germain-en-Laye ...
-
bioRxiv - Cell Biology 2023Quote: ... living colours GFP monoclonal antibody (Takara, Cat# 632375) at 1:5000 dilution and anti-ZWF1 antibody (sigma ...
-
bioRxiv - Neuroscience 2023Quote: ... Primary antibodies: mouse antimCherry (Clontech, Cat. No. 632543), chicken antiGFP (Abcam ...
-
bioRxiv - Immunology 2021Quote: ... 2.5 mM dNTP and 2 U/μL of recombinant RNase inhibitor (Clontech) then spun down and frozen at –80 °C.