Labshake search
Citations for Takara Bio :
301 - 350 of 833 citations for Fatty acid binding protein FABP3 Human His since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biophysics 2019Quote: ... cDNAs encoding cyan fluorescent protein (CFP) and yellow fluorescent protein (YFP) were purchased from Clontech Com ...
-
bioRxiv - Cell Biology 2022Quote: ... Total protein was quantified using the TAKARA BCA Protein Assay Kit (TAKARA Bio Inc., Japan). Equal amounts of protein were separated by SDS-PAGE on 10% gels ...
-
Actin binding domain of Rng2 sparsely bound on F-actin strongly inhibits actin movement on myosin IIbioRxiv - Biophysics 2022Quote: ... which had a TEV protease recognition sequence between the 6×His sequence and the multiple cloning site of pColdI (Takara Bio, Kusatsu, Japan). The amino acid sequence of His-TEV Rng2CHD was MNHKVHHHHHHIEGRHMENLYFQGTLEGSEFKLDVNVGL…(Rng2CHD)…LPNFKA ...
-
bioRxiv - Synthetic Biology 2020Quote: Yeast with the uracil auxotrophy were cultivated in complete synthetic media without uracil prepared with -His-Ura dropout supplement (Clontech, Mountain View, CA) according to manufacturer’s instructions and supplemented with 20 g/mL histidine and 80mg/L adenine hemisulfate (Sigma-Aldrich ...
-
bioRxiv - Biophysics 2019Quote: ... cells bearing the corresponding plasmids and were purified according to.63 Partially purified lysates were loaded onto equilibrated cobalt His-TALON columns (Clontech, Mountain View, CA). The column was washed with 40 to 50 volumes of wash buffer (50 mM NaH2PO4 ...
-
bioRxiv - Neuroscience 2023Quote: ... LRP10 sequence-verified cDNA was subcloned from the pcDNA™3.1-LRP10-V5-His-TOPO® plasmid described previously (9) into the pLVX-EF1α-IRES-mCherry plasmid (Takara Bio, 631987). Briefly ...
-
bioRxiv - Neuroscience 2023Quote: ... LRP10 sequence-verified cDNA was subcloned from the pcDNA™3.1-LRP10-V5-His-TOPO® plasmid (Quadri et al., 2018) into the pLVX-EF1α-IRES-mCherry plasmid (Takara Bio, 631987) via Gibson Assembly® (NEB ...
-
bioRxiv - Immunology 2021Quote: ... and the protein concentration was measured by BCA protein assay kit (TaKaRa, Dalian, China, cat#T9300A) as previous described(Ma et al. ...
-
bioRxiv - Molecular Biology 2022Quote: ... The protein concentration was found to be 0.9 µg/µl using BCA Protein Assay Kit (TaKaRa).
-
bioRxiv - Microbiology 2022Quote: Protein-protein interactions were assayed with the Matchmaker yeast two-hybrid system (Clontech, Mountain View, CA). ORFs of AoHse was amplified from first-strand cDNA of A ...
-
bioRxiv - Physiology 2022Quote: ... Obtained luminescence was normalized to total protein concentration measured by BCA protein assay kit (Takara Bio).
-
bioRxiv - Microbiology 2024Quote: Protein concentrations were determined using the BCA method (TaKaRa BCA Protein Assay Kit; Takara, Shiga, Japan) after 1% SDS was added to solubilize the samples ...
-
bioRxiv - Neuroscience 2021Quote: ... anti-human GFAP (mouse IgG1, 1:2000, Takara Bio, Shiga, Japan), anti-CNPase (mouse IgG1 ...
-
bioRxiv - Physiology 2020Quote: ... the Human MTC Panel I (Cat. No. 636742, Takara Bio Inc.) was used ...
-
bioRxiv - Genomics 2021Quote: Human brain total RNA was obtained from Takara (Cat No. 636530). The RNA was isolated by a modified guanidinium thiocyanate method and has RIN > 9.
-
bioRxiv - Neuroscience 2020Quote: ... Templates for assembly were derived from human whole-brain cDNA (Takara) for all cDNAs ...
-
bioRxiv - Microbiology 2022Quote: ... The human kidney epithelial cell line Lenti-X™ 293T (Takara) was cultivated in DMEM supplemented with 10 % (v/v ...
-
bioRxiv - Biochemistry 2019Quote: ... UBE2E2 and UBE2E3 were cloned from a human cDNA library (Clontech) into the pET-SUMO2 vector (Addgene ...
-
Biosynthesis of Circular RNA ciRS-7/CDR1as Is Mediated by Mammalian-Wide Interspersed Repeats (MIRs)bioRxiv - Molecular Biology 2019Quote: ... Human cerebral cortex total RNA was purchased from Clontech (CLN 636561). From culture cells ...
-
bioRxiv - Genomics 2019Quote: ... DNA-baits were generated by PCR using human genomic DNA (Clontech) as a template ...
-
bioRxiv - Cell Biology 2019Quote: ... Human Sec24C was subcloned into pmCherry-C1 or pEYFP-C1 (Clontech) using XhoI and SacII restriction sites and verified by sequencing ...
-
bioRxiv - Cell Biology 2021Quote: ... Human adult and foetal heart total RNA was purchased from Takara Bio ...
-
bioRxiv - Molecular Biology 2020Quote: ... Cellartis® human iPSC line 22 (ChiPSC22) was obtained from Takara, expanded and cultured using Cellartis DEF-CS Culture System following Cellartis protocol.
-
bioRxiv - Immunology 2020Quote: ... Human MTC™ Panel II (Takara Bio, Mountain View, CA, USA) were used ...
-
bioRxiv - Genetics 2022Quote: ... containing both commercially available human genomic DNA (100ng/µl; ClonTech, #636401) and mutant DNA from either a cell line (c.1620C>A ...
-
bioRxiv - Neuroscience 2023Quote: Human MAP2C cDNA tagged with 6xHis was inserted into pAcGFP (Takara) vector using In- Fusion cloning kit (Takara) ...
-
bioRxiv - Immunology 2023Quote: Lenti-X 293T (human embryonic kidney) cells were purchased from Takara Bio Inc ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... pooled total RNA samples from human liver were obtained from Clontech. Each sample (2 μg ...
-
bioRxiv - Synthetic Biology 2024Quote: ... The human EF1α promoter was sourced from pLVX-Tet3G (Clontech/Takara). Barcodes used for the TUPVs were designed by the Elledge lab34 ...
-
bioRxiv - Synthetic Biology 2024Quote: ... The human EF1α promoter was sourced from pLVX-Tet3G (Clontech/Takara). Barcodes used for the TUPVs were designed by the Elledge lab34 ...
-
bioRxiv - Cell Biology 2024Quote: ... and human adult heart RNA (n=4 pooled, Cat #636583, Takara) were used for bulk RNA sequencing ...
-
bioRxiv - Molecular Biology 2024Quote: ... and the human herpes simplex virus 5 puromycin resistance marker (Clontech).
-
bioRxiv - Neuroscience 2020Quote: Enhanced green fluorescent protein (EGFP, Clontech), Tag-blue fluorescent protein (Tag-BFP ...
-
bioRxiv - Molecular Biology 2022Quote: ... protein was estimated using BCA (TaKaRa), and 100 µg protein was incubated with 20 µl packed protein G-sepharose beads (Sigma P3296 ...
-
bioRxiv - Zoology 2020Quote: ... The protein concentration was measured by TaKaRa BCA Protein Assay Kit (Takara Bio) in accordance with the manufacturer’s protocol ...
-
bioRxiv - Neuroscience 2023Quote: ... 5) cDNA coding eGFP protein (Clontech). 6 ...
-
bioRxiv - Developmental Biology 2019Quote: ... Positive blue colonies were streaked to an -Ade-His-Leu-Trp dropout selective media agar plates supplemented with Aureoblastidin A and X-gal (Clontech yeast two-hybrid manual).
-
bioRxiv - Biochemistry 2021Quote: ... an aliquot of the lysate was used to measure protein concentration by BCA protein assay (Takara Bio). The lysate was mixed with Optiphase Hisafe 3 (PerkinElmer) ...
-
bioRxiv - Immunology 2024Quote: ... The full-length CD177 cDNA inserts were sub-cloned into pBMN-I-EGFP retroviral vector digested with Bam HI and EcoR I restriction enzymes using InFusion HD Cloning Kit (Takara Bio USA, Mountain View, Ca) according to the product manual ...
-
bioRxiv - Cancer Biology 2019Quote: Full-length EML4 cDNA was isolated by PCR from human cDNA (Clontech) and subcloned into a version of pcDNA3 or pcDNA3.1-hygro (Invitrogen ...
-
bioRxiv - Genomics 2020Quote: ... Human universal reference total RNA (Catalog No. 636538, Clontech, Mountain View, CA) was used as a template to synthesize cDNA by reverse transcription ...
-
bioRxiv - Cell Biology 2021Quote: For expression analysis human multiple tissue cDNA panel (MTC™ Clontech, 636742) and human normal brain tissue qPCR array (OriGene Technologies ...
-
bioRxiv - Cell Biology 2022Quote: Naïve human PSCs were cultured in the PXGL medium: Ndiff227 (Takara Bio) medium supplemented with PD0325901 (Sigma,1 μM) ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: ... commercially available cDNAs originating from various human tissues were purchased from TaKaRa (detailed sample information is given in Table S3 ...
-
bioRxiv - Genomics 2019Quote: ... Wild-type sequences were generated by PCR using human genomic DNA (Clontech) as a template ...
-
bioRxiv - Cell Biology 2020Quote: ... Adenovirus expressing human SPARC was constructed using Adeno-X expression system (Clontech) as described before 30,31 ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... pooled total RNA of human kidney and liver were purchased from Clontech. Total RNA (2 µg ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... 10 ng cDNA of various tissues (Takara Human MTC panel I & II) were used for each reaction and amplified by KOD Xtreme Hot Start DNA polymerase kit (Takara) ...
-
bioRxiv - Evolutionary Biology 2020Quote: Total RNA from human tissues was purchased from Clontech (catalog number 636643). Most of these samples represent pooled RNA from multiple individuals (between 2 and 63 individuals) ...
-
bioRxiv - Neuroscience 2022Quote: ... were purchased from Addgene and Genscript or amplified from human adult and fetal brain RNA (Takara) (see Table S10)(Alford et al. ...