Labshake search
Citations for Evrogen :
51 - 100 of 117 citations for rno mir 542 5p Real time RT PCR Detection Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2021Quote: ... ScreenMix Kit (Evrogen) was used according to the manufacturer’s protocol ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... PCR was performed in 15 μl reaction mixture of Screen Mix (Evrogen, Russia) in a Veriti Thermal Cycler (Applied Biosystems ...
-
bioRxiv - Immunology 2023Quote: ... Capillary sequences of the target PCR products were obtained as a service (Evrogen, Russia).
-
bioRxiv - Cell Biology 2020Quote: ... we PCR amplified the coding region of the far-red fluores-cent protein turboFP635 (Evrogen) using primer sequences 5’-TGTACCGGTCTCGAGGCCACCAT-GGTGGGTGAGG and 5’-AGATCCGGAGCTGTG-CCCCAGTTTGCTA ...
-
bioRxiv - Pathology 2020Quote: ... Quick-TA kit (Evrogen JSC) was used for cloning ...
-
bioRxiv - Neuroscience 2019Quote: ... the mRit2 coding region was PCR-amplified and subcloned in-frame into the pTagRFP-C vector (Evrogen) at HindIII/XbaI sites ...
-
bioRxiv - Cell Biology 2022Quote: ... EB1-TagRFP was generated by PCR amplification from KAZUSA cDNA (NCBI AB463888) and inserted into pTagRFP-N (Evrogen). The shRNA target sequence was designed for protein knockdown using the BLOCK-iT RNAi Designer tool (Thermo Fisher Scientific) ...
-
A quantitative tri-fluorescent yeast two-hybrid system: from flow cytometry to in-cellula affinitiesbioRxiv - Biochemistry 2019Quote: ... The coding sequence for Tag-RFP was subsequently introduced in the EcoRI site through PCR from pTag_RFP-Actin (Evrogen), using the primers primSB_0003 and 0004 ...
-
bioRxiv - Cell Biology 2021Quote: ... and 5’-ccgggggcggccgctcaaagcttacttttgttcatatgtttattcaatgca-3’ (for pMF1992)) and subcloning the BamHI/NotI-restricted PCR products into the BamHI/NotI-restricted backbone fragments of pKillerRed-dMito (Evrogen) (for pMF1991 ...
-
bioRxiv - Microbiology 2020Quote: The plasmid expressing phoP and phoQ was constructed by cloning the PCR fragment amplified with the Tersus DNA polymerase (Evrogen) and the phoPQf1 and phoPQr primers into the low copy number vector pZH449.
-
bioRxiv - Molecular Biology 2021Quote: ... with a Screen Mix-HS polymerase kit (Evrogen). Amplifications were performed using a S1000™ thermal cycler (Bio-Rad ...
-
bioRxiv - Molecular Biology 2021Quote: ... gel-purified using the Cleanup Standard kit (Evrogen) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2021Quote: ... gel-purified using the Cleanup Standard kit (Evrogen) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2023Quote: RNA was isolated using the ExtractRNA kit (Evrogen). RNA concentration was determined using a Nanodrop One C spectrophotometer (Thermo Fisher Scientific) ...
-
bioRxiv - Biochemistry 2024Quote: ... woodyi cells using an RNA Solo kit (Evrogen) and additionally digested with RNase-free DNase I (Thermo Scientific ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... the number of molecules in each library was validated by real-time PCR using 2.5x Reaction mixture for PCR-RV in the presence of EVA Green (SINTOL, Russia) and primers for Illumina adapters (Evrogen, Russia). Further ...
-
Molecular coevolution of nuclear and nucleolar localization signals inside basic domain of HIV-1 TatbioRxiv - Evolutionary Biology 2021Quote: ... The amplified PCR product was digested with EcoRI and BamHI and then inserted into the pTagRFP-N1 vector (Evrogen, Moscow, Russia). After cloning into an expression vector ...
-
bioRxiv - Plant Biology 2020Quote: Amplification of TALE genes was performed via a two-step PCR process in conjunction with primers 5’-GATCCCATTCGTTCGCGCACACCAAGTC-3’ and 5’-CTCCATCAACCATGCGAGCTCCTCTTCG-3’ and Taq DNA polymerase (Evrogen, Russia) under the following conditions ...
-
bioRxiv - Biochemistry 2019Quote: The gene encoding the transmembrane domain of the human TrkA-TM (MK410KDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK447) was amplified by PCR from six chemically synthesized oligonucleotide templates (Evrogen, Russia) whose sequences partially overlapped along its sequence ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Cell Biology 2021Quote: ... a DNA fragment containing the hepatitis A virus 3C protease (3Cpro) gene with EcoRI and KpnI sites was generated by PCR using the primers GACTGAATTCGCCACCATGTCAACTCTAGAAATAGCAGG and CAACGGTACCTTACTGACTTTCAATTTTCTTATCAATG (Evrogen, Russia), and pBI-EGFP-3C [11] as the template ...
-
bioRxiv - Molecular Biology 2023Quote: ... 700 ng of PCR product was taken per one 100µl aliquot of E.coli XL1-Blue competent cells (Evrogen, Moscow, Russian Federation).
-
bioRxiv - Plant Biology 2020Quote: ... RNA was extracted using the ExtractRNA kit (Evrogen, Russia), the quality and quantity of preparations of total RNA and RNA from polysomal and monosomal fractions of plants was evaluated on an Agilent Bioanalyzer 2100 ...
-
bioRxiv - Plant Biology 2020Quote: ... thermocycler using the ScreenMix-HS kit (Evrogen, Moscow, Russia). The PCR cycling conditions were as follows ...
-
bioRxiv - Zoology 2019Quote: RNA extraction was performed using a ExtractRNA kit (Evrogen). An Agilent Technologies 2100 Bioanalyzer or 2200 TapeStation were used to establish that the RNA Integrity Number (RIN ...
-
bioRxiv - Neuroscience 2020Quote: ... Libraries were normalized using the Evrogen Trimmer kit (Evrogen). Libraries were sequenced as 50 bp single-end reads at the Emory University genomics core facility using Illumina GAIIX ...
-
bioRxiv - Genomics 2020Quote: Normalization was done using Trimmer Kit (Evrogen, Moscow, Russia). One μg pooled GBS library in 12 μl was mixed with a 4 μl 4x hybridization buffer ...
-
bioRxiv - Biochemistry 2020Quote: ... The DNA fragment encoding the RBDv1 ORF with Kozak consensus sequence and C-terminal c-myc and 6xHis tags were obtained by PCR using primers AD-COV-AbsF and AD-RBD-myc6HNheR (listed in Table 1) and Tersus polymerase mix (Evrogen, Moscow, Russia). Synthetic oligo’s ...
-
bioRxiv - Molecular Biology 2023Quote: ... into enhanced Piggybac (ePB) doxycycline-inducible expression vectors.46 Overlap PCR constructs encoding FLAG-APEX2 fusions with mKate2 fluorescent protein (Evrogen, cat. #FP181) were cloned between BamHI and NotI sites in ePB vectors as follows ...
-
bioRxiv - Biochemistry 2020Quote: ... First strand of cDNA was synthesized using Mint kit (Evrogen) with primers for k-chain (TTG TCG TTC ACT GCC ATC AAT C) ...
-
bioRxiv - Immunology 2021Quote: ... The restricted polynucleotides were purified with Cleanup Standard Kit (Evrogen) and ligated with T4 DNA ligase in the corresponding buffer (Evrogen ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... A custom normalization step (based on the EVROGEN Trimmer kit) was optimized in collaboration with the Roche R&D department and applied to the cDNA libraries ...
-
bioRxiv - Genomics 2020Quote: ... was performed using the Trimmer-2 cDNA normalisation kit (Evrogen) following the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2023Quote: ... cDNA was synthesized using the MMLV reverse transcription kit (Evrogen) according to the manufacturer’s protocol ...
-
bioRxiv - Plant Biology 2023Quote: ... After purification using the Cleanup Standard kit (Evrogen, Moscow, Russia), the restriction products were ligated using T4 ligase (Evrogen ...
-
bioRxiv - Molecular Biology 2020Quote: ... pET-NS1 was purified using a Plasmid Miniprep Kit (Evrogen, BC021). Commercial plasmid sequencing was performed using T7 primers at Evrogen (Moscow ...
-
bioRxiv - Cell Biology 2021Quote: ... The fragment was purified using a Cleanup Standard kit (Evrogen, Russia), digested with EcoRI and KpnI enzymes (SibEnzyme ...
-
bioRxiv - Cancer Biology 2023Quote: RNA was extracted from cultured cells using the ExtractRNA kit (Evrogen) according to the manufacturer’s protocol ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Midiprep was prepared using the Plasmid Midiprep 2.0 kit (Evrogen, #BC124) according to the manufacturer’s instructions.
-
bioRxiv - Synthetic Biology 2024Quote: ... Midipreps were prepared using the Plasmid Midiprep 2.0 kit (Evrogen, #BC124) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2021Quote: ... and kRas was amplified using the Encyclo GC polymerase kit (Evrogen; Russia), and control duplex 0Myc ...
-
bioRxiv - Cell Biology 2022Quote: ... cDNA was synthesized using the MMLV reverse transcription kit (Evrogen, Moscow, Russia) with an oligo-dT primer ...
-
bioRxiv - Molecular Biology 2021Quote: ... Plasmid DNA for transfection was isolated using Plasmid Miniprep Kit (Evrogen, Russia) according to the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2021Quote: ... coli TG1 cells and purified using a Plasmid Miniprep kit (Evrogen, Russia).
-
bioRxiv - Plant Biology 2020Quote: ... Total RNA was extracted from each fraction using the ExtractRNA kit (Evrogen, Russia). In each fraction ...
-
bioRxiv - Genomics 2020Quote: ... USA) and normalized using the Trimmer cDNA Normalization kit from Evrogen (Moscow, Russia). The libraries were sequenced on a 454 genome sequencer FLX Titanium machine (Roche ...
-
bioRxiv - Plant Biology 2020Quote: ... RNA was converted to cDNA using a Mint cDNA synthesis kit (Evrogen, Russia). The primers for reverse transcription included custom barcodes unique to each sample ...
-
bioRxiv - Microbiology 2022Quote: ... and plasmid DNA was isolated using the Plasmid Miniprep/BC021S kit (Evrogen, Russia). The bla gene sequence and pblaTEM plasmid type were confirmed by PCR and Sanger sequencing.
-
bioRxiv - Evolutionary Biology 2023Quote: ... qPCR was carried out with 5X qPCRmix-HS SYBR + LowROX kit (Evrogen JSC) on the CFX96 Real-Time System (Bio- Rad ...
-
bioRxiv - Molecular Biology 2021Quote: ... the resulting product was cleaned from 2% agarose gel by Cleanup Standard Kit (Evrogen), digested by MluI and HindIII and ligated into pMV306/MluI ...