Labshake search
Citations for Evrogen :
1 - 50 of 77 citations for Somatostatin Receptor 1 SSTR1 Rabbit Polyclonal affinity purified Alexa488 labeled since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2022Quote: ... rabbit polyclonal anti-tagRFP (Evrogen, 1:1000). HRP-conjugated goat anti-mouse and goat anti-rabbit IgG (H+L ...
-
bioRxiv - Genomics 2023Quote: ... 2: rabbit anti-tRFP (1:1,000 dilution, polyclonal, Evrogen, AB233). The following secondary antibodies were used ...
-
bioRxiv - Zoology 2019Quote: ... and rabbit polyclonal for turboRFP/mKate2 (diluted 1:500; Evrogen AB234). Secondary antibodies (all diluted 1:2000) ...
-
bioRxiv - Plant Biology 2023Quote: ... polyclonal anti-tBFP produced in rabbit (Evrogen) were used as primary antibodies ...
-
bioRxiv - Neuroscience 2023Quote: ... and Anti-tRFP (rabbit polyclonal, AB233, Evrogen), both at 1:500 dilution ...
-
bioRxiv - Molecular Biology 2020Quote: ... we used rabbit polyclonal Anti-tRFP and Anti-TurboGFP(d) antibodies (Evrogen, Russia) diluted at 1:7000 ...
-
bioRxiv - Microbiology 2020Quote: ... Chlamydiae were stained with polyclonal a rabbit anti-tRFP antibody (Evrogen, Cat. # 233), which recognized the RFP mKate protein ...
-
bioRxiv - Plant Biology 2021Quote: ... tagRFP fusion proteins were detected using the anti-tRFP (rabbit polyclonal, Evrogen AB233) diluted 1:5000 (v/v) ...
-
bioRxiv - Neuroscience 2019Quote: ... They were then incubated with primary antibodies, rat monoclonal anti-GFP (Nacalai Tesque, GF090R) at 1:2000 and rabbit polyclonal anti-tRFP (Evrogen, AB233) at 1:2000 ...
-
bioRxiv - Developmental Biology 2020Quote: ... and anti-tRFP Rabbit (Evrogen, 1:250). Secondary antibodies used were goat anti-Rabbit Alexa Fluor 488 (Invitrogen ...
-
bioRxiv - Neuroscience 2021Quote: ... Rabbit anti-tRFP 1:500 (Evrogen AB233), Rabbit anti-S100 1:300 (VWR/ProteinTech 15146-1-AP) ...
-
bioRxiv - Cancer Biology 2023Quote: ... rabbit anti-RFP (Evrogen, AB234, 1:1000), chicken anti-GFP (Novus ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-tagRFP (1:250, Evrogen AB233), chicken anti-PV (1:250 ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-tagRFP (1:100, Evrogen AB233), goat anti-chicken biotin (1:200 ...
-
bioRxiv - Biophysics 2019Quote: ... rabbit anti-tagRFP pAb (1:1000; ab233, Evrogen), mouse anti-PLB mAb (1:1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... fRed (rabbit anti-tRFP, 1:500; AB233, Evrogen), or eGFP (chicken ...
-
bioRxiv - Molecular Biology 2020Quote: ... rabbit anti-TagRFP (Evrogen: AB233; RRID: AB_2571743; 1:1,000) and mouse anti-β-actin conjugated to HRP (Sigma-Aldrich ...
-
bioRxiv - Cell Biology 2019Quote: ... or 1:1000 rabbit α-RFP (AB233, Evrogen, Moscow, Russia). The following secondary antibodies were then used at 1:5000 dilution ...
-
bioRxiv - Neuroscience 2022Quote: ... 500-1000 μl of rabbit anti fRed (1:500; AB233, Evrogen) primary antibody was used per slice in a 2 ml Eppendorf tube ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Neuroscience 2023Quote: ... Primary antibodies (goat a-ChAT Millipore AB144P 1:200 and chicken a-RFP Rockland 600-901-379 1:1000 or rabbit a-tRFP Evrogen AB233 1:1000) were prepared in light blocking solution (3% NDS ...
-
bioRxiv - Pathology 2019Quote: ... The protein samples were detected with a polyclonal anti-tRFP antibody (Evrogen) for TagBFP ...
-
bioRxiv - Molecular Biology 2021Quote: ... gel-purified using the Cleanup Standard kit (Evrogen) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2021Quote: ... gel-purified using the Cleanup Standard kit (Evrogen) according to the manufacturer’s instructions ...
-
Kinetics Of Interferon-λ And Receptor Expression In Response To In Vitro Respiratory Viral InfectionbioRxiv - Immunology 2021Quote: ... were commercially synthesized and HPLC- purified (Evrogen, Russia).
-
bioRxiv - Cancer Biology 2023Quote: RNA was purified using ExtractRNA (Evrogen, Moscow, Russia) according to the manufacturer’s protocol ...
-
bioRxiv - Genomics 2024Quote: ... and purified using spin columns (Evrogen, cat. no. BC033). DNA was isolated using the gravity flow Genomic Tip kit (Qiagen ...
-
bioRxiv - Neuroscience 2023Quote: ... was used to visualize LC neurons and rabbit anti-red fluorescent protein to visualise the fRed tag (tRFP, 1:1000, Evrogen). For visualisation of GRABNE2m expression in the hippocampus ...
-
bioRxiv - Biochemistry 2020Quote: ... Obtained DNA was purified and cloned into pKAN-T (Evrogen) vector that was subsequently sequenced ...
-
bioRxiv - Immunology 2021Quote: ... The restricted polynucleotides were purified with Cleanup Standard Kit (Evrogen) and ligated with T4 DNA ligase in the corresponding buffer (Evrogen ...
-
bioRxiv - Cell Biology 2020Quote: ... Rabbit anti-Tag(CGY)FP (Evrogen) was used at 1:1000 to detect mTagGFP2 ...
-
bioRxiv - Microbiology 2022Quote: ... α-tRfp from rabbit (AB233-EV, Evrogen) and α-Actin from mouse (MP Biomedicals ...
-
bioRxiv - Microbiology 2020Quote: ... This was incubated with the appropriate antibodies (anti-GFP polyclonal antibody and anti-tRFP antibody, Evrogen, reference # AB233) and revealed with Roche LumiLight ECL kit after incubation with secondary antibody.
-
bioRxiv - Molecular Biology 2020Quote: ... pET-NS1 was purified using a Plasmid Miniprep Kit (Evrogen, BC021). Commercial plasmid sequencing was performed using T7 primers at Evrogen (Moscow ...
-
bioRxiv - Cell Biology 2021Quote: ... The fragment was purified using a Cleanup Standard kit (Evrogen, Russia), digested with EcoRI and KpnI enzymes (SibEnzyme ...
-
bioRxiv - Genetics 2019Quote: ... rabbit anti-tRFP was from Evrogen (#AB233) and used against mKate2 to stain cystinosin-mKate2 ...
-
bioRxiv - Cell Biology 2021Quote: ... coli TG1 cells and purified using a Plasmid Miniprep kit (Evrogen, Russia).
-
bioRxiv - Bioengineering 2019Quote: ... the ligation mixture was purified on Cleanup Mini DNA purification columns (Evrogen). 40 μl of electrocompetent cells were thawed on ice ...
-
bioRxiv - Neuroscience 2020Quote: ... rabbit anti-tRFP (tagBFP, AB233, Evrogen, Moscow, Russia) and mouse anti-GAPDH (MAB374 ...
-
bioRxiv - Cell Biology 2022Quote: ... Rabbit anti-turboGFP (AB513) was purchased from Evrogen. Goat anti-GFP (GTX26673 ...
-
bioRxiv - Cell Biology 2019Quote: ... Membranes were incubated overnight with rabbit anti-tagRFP (which recognise also tagBFP) or rabbit anti-tag(CGY)FP primary antibodies (both from Evrogen, Milan, Italy) at 1:5000 in PBST with 0.5% non-fat dry milk ...
-
C53 interacting with UFM1-protein ligase 1 regulates microtubule nucleation in response to ER stressbioRxiv - Cell Biology 2020Quote: Rabbit Ab to tRFP was from Evrogen (Moscow, Russia). Mouse mAbs GCP2-01 (IgG2b ...
-
bioRxiv - Biochemistry 2020Quote: ... plasmid # 162785 Plasmids for cell transfections were purified by the Plasmid Midiprep kit (Evrogen, Moscow, Russia) and concentrated by ethanol precipitation in sterile conditions.
-
bioRxiv - Immunology 2021Quote: ... The resulting NemR-cpYFP-bearing vectors were purified with the use of Plasmid Miniprep Kit (Evrogen) according to the manufacturer’s protocol ...
-
bioRxiv - Microbiology 2024Quote: ... and rabbit monoclonal antibodies to GFP (598; MBL) and TagRFP (AB233; Evrogen). Rabbit polyclonal antibodies to US11 were described previously 41 ...
-
bioRxiv - Microbiology 2023Quote: ... Wells were screened by PCR for the presence of lysate with recombinant phages and T3Δ0.3 was further purified from individual plaques and verified by Sanger sequencing (Evrogen).
-
bioRxiv - Immunology 2021Quote: ... the corresponding gene was amplified with the use of the №17/№34 primer pair and purified with Cleanup Standard Kit (Evrogen). The obtained construct and intact PCS2+ vector were incubated with ClaI and XbaI FastDigest™ enzymes in the corresponding buffer (Thermo Scientific ...
-
bioRxiv - Immunology 2021Quote: ... the target product was separated from the nontarget byproducts with horizontal DNA electrophoresis in agarose gel and purified with Cleanup Standard Kit (Evrogen). To engineer pQE30-NemR-cpYFP plasmids ...
-
bioRxiv - Developmental Biology 2021Quote: ... TagRFP (1: 1000, Evrogen, AB233), GFP (1 ...
-
bioRxiv - Neuroscience 2022Quote: ... TurboRFP (1:1000, Evrogen AB233), GFP (1:1000 ...