Labshake search
Citations for Evrogen :
1 - 50 of 87 citations for Rat Neuronal Acetylcholine Receptor Subunit Alpha 7 CHRNA7 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Neuroscience 2019Quote: ... They were then incubated with primary antibodies, rat monoclonal anti-GFP (Nacalai Tesque, GF090R) at 1:2000 and rabbit polyclonal anti-tRFP (Evrogen, AB233) at 1:2000 ...
-
bioRxiv - Immunology 2021Quote: ... ScreenMix Kit (Evrogen) was used according to the manufacturer’s protocol ...
-
bioRxiv - Pathology 2020Quote: ... Quick-TA kit (Evrogen JSC) was used for cloning ...
-
bioRxiv - Immunology 2021Quote: Tersus Plus PCR Kit (Evrogen) was used for all amplification procedures ...
-
bioRxiv - Genomics 2020Quote: Encyclo PCR Kit (Evrogen, Russia) was used for the evaluation of the transposable element analysis ...
-
bioRxiv - Cancer Biology 2023Quote: ... OneTube RT-PCR SYBR kit (Evrogen) was used for cDNA production by reverse transcription followed by qPCR ...
-
bioRxiv - Cell Biology 2021Quote: ... for reverse transcription (MMLV RT kit) and for real time PCR (HS SYBR kit) were obtained from Evrogen, Russia ...
-
bioRxiv - Molecular Biology 2021Quote: ... with a Screen Mix-HS polymerase kit (Evrogen). Amplifications were performed using a S1000™ thermal cycler (Bio-Rad ...
-
bioRxiv - Molecular Biology 2021Quote: ... gel-purified using the Cleanup Standard kit (Evrogen) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2021Quote: ... gel-purified using the Cleanup Standard kit (Evrogen) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2023Quote: RNA was isolated using the ExtractRNA kit (Evrogen). RNA concentration was determined using a Nanodrop One C spectrophotometer (Thermo Fisher Scientific) ...
-
bioRxiv - Biochemistry 2024Quote: ... woodyi cells using an RNA Solo kit (Evrogen) and additionally digested with RNase-free DNase I (Thermo Scientific ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Using the Tersus Plus PCR kit (Evrogen, PK221), blunting of the protruding ends in combination with A-tail treatment was performed ...
-
bioRxiv - Plant Biology 2020Quote: ... RNA was extracted using the ExtractRNA kit (Evrogen, Russia), the quality and quantity of preparations of total RNA and RNA from polysomal and monosomal fractions of plants was evaluated on an Agilent Bioanalyzer 2100 ...
-
bioRxiv - Plant Biology 2020Quote: ... thermocycler using the ScreenMix-HS kit (Evrogen, Moscow, Russia). The PCR cycling conditions were as follows ...
-
bioRxiv - Zoology 2019Quote: RNA extraction was performed using a ExtractRNA kit (Evrogen). An Agilent Technologies 2100 Bioanalyzer or 2200 TapeStation were used to establish that the RNA Integrity Number (RIN ...
-
bioRxiv - Neuroscience 2020Quote: ... Libraries were normalized using the Evrogen Trimmer kit (Evrogen). Libraries were sequenced as 50 bp single-end reads at the Emory University genomics core facility using Illumina GAIIX ...
-
bioRxiv - Genomics 2020Quote: Normalization was done using Trimmer Kit (Evrogen, Moscow, Russia). One μg pooled GBS library in 12 μl was mixed with a 4 μl 4x hybridization buffer ...
-
bioRxiv - Biochemistry 2024Quote: ... cDNA was synthesized using the MMLV RT kit (Evrogen) with random decanucleotide primers ...
-
bioRxiv - Genomics 2022Quote: Reverse transcription was performed using MMLV RT kit (Evrogen SK021). The synthesis was primed with oligo(dT) ...
-
bioRxiv - Molecular Biology 2021Quote: ... smegmatis genomic DNA by using Tersus Plus PCR kit (Evrogen) with primers (−47 ...
-
bioRxiv - Biochemistry 2020Quote: ... First strand of cDNA was synthesized using Mint kit (Evrogen) with primers for k-chain (TTG TCG TTC ACT GCC ATC AAT C) ...
-
bioRxiv - Immunology 2021Quote: ... The restricted polynucleotides were purified with Cleanup Standard Kit (Evrogen) and ligated with T4 DNA ligase in the corresponding buffer (Evrogen ...
-
bioRxiv - Evolutionary Biology 2020Quote: ... A custom normalization step (based on the EVROGEN Trimmer kit) was optimized in collaboration with the Roche R&D department and applied to the cDNA libraries ...
-
bioRxiv - Genomics 2020Quote: ... was performed using the Trimmer-2 cDNA normalisation kit (Evrogen) following the manufacturer’s instructions ...
-
bioRxiv - Bioengineering 2019Quote: DNA amplification was performed using the Encyclo PCR Kit (Evrogen) on a PTC-200 Thermal Cycler (MJ Research) ...
-
bioRxiv - Developmental Biology 2021Quote: ... Amplification was performed using EncycloPlus PCR kit (Evrogen, Moscow, Russia) using the following program ...
-
bioRxiv - Plant Biology 2022Quote: cDNA was synthesized using the MMLV RT kit (Evrogen, Russian) according to the manufacturer’s recommendations ...
-
bioRxiv - Molecular Biology 2023Quote: ... cDNA was synthesized using the MMLV reverse transcription kit (Evrogen) according to the manufacturer’s protocol ...
-
bioRxiv - Plant Biology 2023Quote: ... After purification using the Cleanup Standard kit (Evrogen, Moscow, Russia), the restriction products were ligated using T4 ligase (Evrogen ...
-
bioRxiv - Molecular Biology 2020Quote: ... pET-NS1 was purified using a Plasmid Miniprep Kit (Evrogen, BC021). Commercial plasmid sequencing was performed using T7 primers at Evrogen (Moscow ...
-
bioRxiv - Cell Biology 2021Quote: ... The fragment was purified using a Cleanup Standard kit (Evrogen, Russia), digested with EcoRI and KpnI enzymes (SibEnzyme ...
-
bioRxiv - Biochemistry 2023Quote: ... RT-qPCR assays were performed with qPCRmix-HS SYBR kit (Evrogen), using the cDNA preparations as templates and 5’-GCAAGCGCATTTCAAGGAC / 5’-CCAGCGGGTGAAGTTCGTAG as primer pair for crdB ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Midipreps were prepared using the Plasmid Midiprep 2.0 kit (Evrogen, #BC124) according to the manufacturer’s instructions ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Midiprep was prepared using the Plasmid Midiprep 2.0 kit (Evrogen, #BC124) according to the manufacturer’s instructions.
-
bioRxiv - Cancer Biology 2023Quote: RNA was extracted from cultured cells using the ExtractRNA kit (Evrogen) according to the manufacturer’s protocol ...
-
bioRxiv - Molecular Biology 2021Quote: ... and kRas was amplified using the Encyclo GC polymerase kit (Evrogen; Russia), and control duplex 0Myc ...
-
bioRxiv - Molecular Biology 2021Quote: ... All amplification reactions were done with the Tersus Plus PCR kit (Evrogen).
-
bioRxiv - Cell Biology 2022Quote: ... cDNA was synthesized using the MMLV reverse transcription kit (Evrogen, Moscow, Russia) with an oligo-dT primer ...
-
bioRxiv - Cancer Biology 2019Quote: ... Reverse transcription was performed using a MMLV RT kit (SK021, Evrogen, Russia) and random hexamer primers ...
-
bioRxiv - Molecular Biology 2021Quote: ... Plasmid DNA for transfection was isolated using Plasmid Miniprep Kit (Evrogen, Russia) according to the manufacturer’s instructions ...
-
bioRxiv - Biochemistry 2022Quote: ... RT-qPCR assays were done with the qPCRmix-HS SYBR kit (Evrogen), using the cDNA preparations as templates and 5’-CGGCGCAAACACATACCT / 5’-GCCCGGTTGTTCAATCTCT as primer pair ...
-
bioRxiv - Cell Biology 2021Quote: ... coli TG1 cells and purified using a Plasmid Miniprep kit (Evrogen, Russia).
-
bioRxiv - Plant Biology 2023Quote: ... The reaction was performed using the MMLV RT kit (Evrogen, Moscow, Russia) according to the manufacturer’s instructions ...
-
bioRxiv - Biochemistry 2024Quote: ... RT-qPCR assays were performed with a qPCRmix-HS SYBR kit (Evrogen), using the cDNA preparations as templates and A1/A2 and D3/D4 primer pairs (Table S1 ...
-
bioRxiv - Synthetic Biology 2024Quote: ... The PCR product was extracted using the Cleanup Standard kit (Evrogen, BC022S), and then treated with T4 polynucleotide kinase (Thermo Scientific ...
-
bioRxiv - Molecular Biology 2023Quote: ... PCR fragments were gel-extracted using the Cleanup Standard kit (Evrogen, BC04) and sequenced using were sequenced using NovaSeq 6000 with 300 paired-end cycles.
-
bioRxiv - Plant Biology 2020Quote: ... Total RNA was extracted from each fraction using the ExtractRNA kit (Evrogen, Russia). In each fraction ...
-
bioRxiv - Genomics 2020Quote: ... USA) and normalized using the Trimmer cDNA Normalization kit from Evrogen (Moscow, Russia). The libraries were sequenced on a 454 genome sequencer FLX Titanium machine (Roche ...